KEGG   Rattus norvegicus (rat): 311968Help
Entry
311968            CDS       T01003                                 

Gene name
Kmt2e, Mll5
Definition
lysine (K)-specific methyltransferase 2E (EC:2.1.1.43)
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rno00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
4q11
AA seq 1856 aa AA seqDB search
MSIAIPLGVDTTETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSGLISKNEVGIFTTPHFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLAASRAPKVTDKRRKKSGEKEQNFPK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFVWETKIKAWMDRYEEANNNQYSEGVQREA
QRLAQRLGSGSDSKDMSKPELSVNSSLFRPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IEEGTIHLYIYSTQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESTEN
INSGYETRRKKGKKEKDISKEKDIQNQNITLDCEGTNNKIRSPETKQRKLSPLRLSVSNN
QEPDFIDDMEEKTPISTEVEMESEEQIAERRRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVRPECKESQVISDADVVQEQVKEETAIKPTAAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDVEVMSQQNDIENTVLAIEPETEAAVAEIITEVEAPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDSLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKKRRKETTENISGSCKKRWLKQALEEENSTVLHRYHSPCQ
ERPRSPTVNGESKSPLLLSDSCSLPDLTTPLKKRRLYQLLDSAYSESSTPTPSPYATPTH
TDITPTDPAFATPPRIKSDDETYRNSYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRCTYNQEGYDRPSTMLTLGPFRNSNLNELGLQEIKTIGYTSPRSRTEVNRPCPGEKESV
SDLQLGLDAVEPAALQKTMETPAHDRTEPSSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEIGGGFRISESKCLTQDDARGMFMETAVFCPSEDGLVSGFGRTVNDS
LIDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKPENLALISVSPHPSGTLSSSGDGCV
HSSENGEQPENRASLPLAPPAAACTASCEEGSSDCPVRDANPTEKTDPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDGGGESPCVSCSPSHVQSSPSSHSNHIPQVPAQSLAPPLTE
PMADLDPEGTEATSTSECPSPDTSQSPSKTSKPGSPGPINPAQSHGKMLTKPDSHWEATA
TVSEAESSVHLKPELQQKQLSSNTPALSKNHPPQAHVRNANDQLPQKLPSAPTKLHCPPS
PHTENPPQSSTPHTPVQHGYLSPKPPSQHLGSPFRPHHSQSPQVGTPQRETPRSLYPAAQ
NLQANAQQAPCGALFTQTPSGQSSAAYSPFNQQALSSPAPPPPPPPPPSAYYQNQQPSAN
FQNYNQLKGSLSQQTVFTSGPNQALPGTTSQPSVPGHHVTPGHFLPSQNPTIHHQTAAAV
VPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGTVHAVTPGSHIHSQTVGHHLPPPPPPPG
PAPHHHPPPHPSTGLQSLQAQHQHVVNSAPPPPPPPPPPASVLVSGHHSASGQALHHPPH
QGPPLFPASVHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVPGPHLQPQGPNSIP
TPTASGFCPHPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5571 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagcgatcccattgggggttgatacaacagaaacatcctacttggaaatggct
gcaggctcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcccatcattcacacagctacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccagcatccccgcctcca
tcaggtctcattagcaaaaacgaagtaggcatattcaccactcctcactttgacgagact
tccagtgctactacaatcagcacgtctgaagatgggagctacggcactgacgtgacccgg
tgcatatgtggctttacacacgatgacggctacatgatctgctgtgacaaatgcagtgtt
tggcaacatattgactgcatggggattgacaggcagcatattcctgatacatatctatgt
gaacgttgtcagcccaggagtttggataaagagagggcagtgctactgcaacgccggaaa
agagaaaatatgtcagatggtgacaccagtgcaactgaaagtggcgatgaggtccccgtg
gaattatacactgcattccagcacactccaacttcaatcaccttagctgcttccagagcc
cccaaggtcactgataagaggaggaaaaaaagtggggagaaagaacaaaactttccaaaa
tgtaaaaaagcatttcgtgaaggatctaggaaatcatcaagggttaagggttcagcacca
gaaattgatccttcgtctgatggttcaaattttgtatgggagacaaaaatcaaagcatgg
atggatcgctacgaagaagcaaataataaccagtatagcgagggcgtgcagagagaggcg
caaagactagcgcaaagactcggcagtgggagtgacagcaaagacatgagtaaaccagaa
ttgagtgtcaacagctccctcttcagacctcctgtagagagccatatacagaagaataaa
aaaattctgaaatctgccaaagacttgcctcctgatgcacttatcattgaatacagagga
aagtttatgctgagagaacagtttgaagcaaatggatatttctttaaaaggccataccct
tttgttttattctactccaagttccatgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcgattcatcaggcgttcttgtacaccgaatgcagaggtgaggcatgaa
attgaagaggggaccatacatctctacatttactctacacagagtattccaaaagggact
gaaattactattgcctttgattttgactatgggaattgtaaatacaaggtggactgtgcg
tgcctcaaggaaaatccagagtgccctgttctaaagcgcagctcagaatctacagaaaac
attaatagtggttatgagaccagaagaaaaaaaggaaaaaaagagaaagacatttcaaaa
gaaaaagatatacaaaatcaaaatattactttggactgtgaaggaacaaacaacaaaata
aggagtccagaaacaaaacagagaaagctttctccattaaggctgtcagtgtccaacaac
caggaaccagattttattgatgatatggaagaaaaaactcctattagcactgaagttgaa
atggaatcagaggagcagattgcggagaggaggaggaagatgacaagagaagaaagaaaa
atggaagcaattctgcaagcttttgccagacttgaaaagagagagaagagacgagaacaa
gctttggaaaggatcagcacagccaagacggaagtcaggcccgagtgtaaggagtcgcag
gtcatctctgacgctgacgtggtccaggaacaagtaaaggaagaaactgctatcaagcca
actgctgccaaagtgaacagaactaagcagagaaaaagcttttctcgtagtaggactcat
attggacagcagcgtcggagacacagaaccgtcagcatgtgttcagacatacagccatcc
tctcccgacgttgaagttatgtcacaacagaatgatattgaaaacactgtgcttgctata
gaaccagaaactgaagctgcagtagcagagataatcactgaagtggaagctccagcactt
aataaatgtcccacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagacagcctttcagaaaggcctctgcgcata
actacagatccagaggtgttagctacacagctcaattctttgccaggtctcacttacagc
ccccatgtatactctactcctaagcattacattagattcacatcaccattcctttcggaa
aaaaagagaagaaaagaaactactgaaaacatttctggctcatgcaaaaagcgatggttg
aagcaagccctggaagaagaaaattcaacagttttacacagatatcattcaccgtgtcag
gaaaggcccaggagccctacagttaatggtgaaagtaaaagtcccctgctgctgagcgac
agctgctccctcccagatttaaccacaccactaaaaaagcgaagactttaccaattgtta
gactcggcttactcagaaagctccacccctactccttcaccatacgccaccccaactcac
acggacatcactcctaccgacccagcatttgctactcccccacggatcaaatcagatgat
gaaacttacagaaatagttataaacccatatattcaccagtgaccccagtgacccctggc
acaccaggaaacaccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagatgcacttacaatcaagagggatatgaccgaccttcaaccatgctaacgctgggg
ccttttagaaattccaacctaaatgagctaggcctgcaagaaataaagaccattggttac
accagccccaggagcaggactgaggttaataggccttgcccaggagaaaaggagtctgtg
tcagaccttcaactgggactcgatgcagtcgagccagctgccttacagaaaaccatggaa
accccagcccatgacaggactgagcccagcagccaactggattcgacccactctggacga
ggcacaatgtattcatcctgggtaaagagtcctgacagaacaggagttaacttctcagta
aactccaacttgagggacttaacaccctctcatcagttggagattggaggcggcttccga
atcagtgagtccaagtgcctgacgcaggatgatgctagaggcatgtttatggagacagct
gtcttttgtccctctgaagatgggcttgtctctggttttggacggactgttaatgacagt
ttgatcgacgggagctgcacgccccagaatccaccacaaaagaaaaaggtctctctacta
gaataccgtaagagacaacgtgaagctaggaagagtggttctaagccagagaaccttgct
ttgattagtgtgtcacctcacccaagtgggactctaagcagcagtggcgatggctgtgtc
cacagcagtgagaacggggagcagccagaaaaccgggctagcttgcctttagcaccgcca
gctgccgcctgcaccgcctcctgtgaagaaggcagcagtgactgtcctgtcagagacgcc
aaccccactgagaagacagacccagaagttcagtggactgcttccacctcagtggagcaa
gtgagagagagaagctatcagagagcgttattgctcagtgaccaccgcaaagacaaagac
ggcgggggagagtcaccatgtgtctcatgttcaccgagtcatgttcagtcttcaccttca
tctcattcaaaccacattccccaggtgcccgctcagagcctagcccctcctttgactgaa
cctatggcagaccttgatcctgaaggtacagaagccacaagtacaagtgaatgtccatcc
cctgacacttctcagagcccttctaaaacaagcaagcctggttcaccagggccaatcaat
cctgctcagtcacatgggaaaatgctcacaaaaccagattcccactgggaggcaactgcc
actgtatcagaagctgagagcagtgttcacctaaaaccagagcttcagcaaaaacagctg
tcaagtaacaccccagcactttcaaagaaccatcctcctcaggcccacgttcgaaatgca
aacgatcaacttccgcaaaagctgccttctgcaccaacaaaattgcactgtcctccgtcc
cctcacacagaaaaccctccccagtcctccacgcctcacacgcctgtgcagcatggttac
ctctcaccaaagcctccttcacagcacctaggatctcccttcaggcctcaccattcacag
tcacctcaagtcggaactcctcaacgcgagactccgagaagtttgtatccagcggcacag
aaccttcaagctaatgctcagcaggcaccttgtggagcgttatttacccagacaccctca
ggccagtcctcggcagcatacagtccgttcaaccaacaggctctgagcagcccggccccg
ccccccccaccccctccgcctccttcagcatactatcaaaaccagcagccctctgcaaac
tttcagaactacaatcagctaaaaggtagtctttcccaacaaactgtgtttacatctgga
ccaaatcaagcacttcctggcaccacaagccagccatccgttcctggacaccatgttact
ccgggccattttctgccgtctcaaaaccctaccattcaccatcaaactgctgctgctgtg
gtcccacccccgcctccaccaccgcctgctccaggacctcacctcgtacaacagccaaac
tcacatcagcagcactctgtagcacatgtagttgggacagttcatgctgtcacccctggg
tcacacattcattctcaaactgttggacaccatttaccaccacctcctccacctcctggt
cctgccccacatcaccatcctccaccccatccttccacaggactgcaaagtctgcaagca
caacaccagcatgtagtaaactcagcacccccaccgccccctcctcctcctcctccagcc
agtgttctggtttctgggcatcattcagcatcaggtcaagccttacatcacccacctcat
caaggacctccactttttcctgcgagtgttcatccggctgtaccgccgtacccctcacaa
gccacacatcacaccactttgggaccgggaccccaacaccagccttccggaacagggcca
cattgtccattaccagttccaggtcctcatctccagccccaaggaccaaacagtattcca
acacctactgcttcagggttctgtcctcatcctcaccctggctctgtggccctgccacat
ggggtgcaaggacctcagcaggcatcgccagtgcctggacagattccaattcacagagca
caggtgccaccaacatttcaaaacaattaccacggttcagggtggcattaa

DBGET integrated database retrieval system