KEGG   Rattus norvegicus (rat): 312272Help
Entry
312272            CDS       T01003                                 

Gene name
Mgam
Definition
maltase-glucoamylase
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    312272 (Mgam)
   00500 Starch and sucrose metabolism
    312272 (Mgam)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    312272 (Mgam)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     312272 (Mgam)
    3.2.1.20  alpha-glucosidase
     312272 (Mgam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
4q22
AA seq 2152 aa AA seqDB search
MNERDAVFEAGNRPRDACRWQRKCCWKPVADPKVPACFFPRNWGYEVTSVPTNTSTGLTA
KLKKLSSPSLFGNDIADALLTAEYQTSSRFHFKITDFNEIRYEVPYENINLVNGTAENSS
LSYDIEVIKKPFSIRVLRKSNQRVLLDTGIGPLQFDQQYLQLSFRLPSSNVYGLGEHVHQ
QYLHNMSWNTWPIFTRDTTPRQGMINLYGAHTFFLCLEDTSGASFGVFLMNSNAMEVTLQ
PAPAITYRTTGGILDFYIFLGNTPEQVVQEYLEVVGRPFLPSYWSLGFQLSRRDYGGIDG
LRQVVQRNRDAEIPYDVQYSDIDYMNGSRDFTIDEQAYPQLSDFAKDLHDNGQKYVIILN
PGIISNTNDEVYFNGSKNRVWIMSSRGFATGEGYAGESVFPDFTNPASLPWWTQQVTEFY
NRLEFDGVWIEMDELATLPPAPKCELNNLNHPPFTPNYSRALDAVFSSKRNFLLSRSTFA
GSGKFAGHWLGNNAASWDDLRWSIPSILEFNLFGIPLVGANICGYENNVTEELCTRWMQL
GAFYPLSRNHNGPEYRDQDPAAFGPNSLLLQSSRHYLNIRYTLLPYLYTLFYRAHTLGET
VARPLVHEFYQDPATWAVHEQFLWGPGLLITPVLYEGKEEAKAYIPDAIWYDYETGLAVQ
WRKQFIDMPLPRDRIGLHLRGGYIFPIQEPNITTEASRKNPLGLIVALDYKREAKGQLYW
DDGVSKGTVSEKNYLLYDFSVTSNHLQAKIINGNYVDPNNIMFTDIRILGMDKEPTDCNV
LFNGNKISTSTCNYNASAKVLIISNLTGLKLGQEFSIEWKLVVNDLEKFNCFPEDPAVSE
ERCKQRGCLWEQTTAPGVPICFYDTIPQYAASNIQYQPTGITMDLTLLENSTSAQAAAAP
RVVSDPLSGKINSLRLSVTYHTENMLQVKIYSTSNKRYEVPVPLNIPSSPLGYSENCLYD
VSVKTNPFGLQIQRKSSGTVIWDTQLPGFTFSEMFLSISTRLPSHYIYGFGETDHTSLRR
NMSWNTWGMFARDEPPLYKKNSYGVHPYYMALEDNSNAHGVLLLNSNAMDVTLQPTPALT
YRTIGGILDFYMVLGPTPELVTQQYTQLIGRPAMPPYWALGFQLSRYGYQSDAEIGNLYS
AMVAARIPYDVQHVDIDYMDRKLDFTLSPNFQNLSVLINQMKTNGMRFILVLDPAISGNE
THYLTFTRGQENNVFIKWPDSNDIVWGKVWPELPNVNVDGSLDLETQLKLYRAYVAFPDF
LRSSTASWWKKEIEELYSNPREPQKSLKFDGLRIDMNEPSNFVDGAVGGCRSEILNNPPY
MPDLEARNVGLSSKTLCMESEQILPDGSRVQHYDVHSLYGWSQTRPTYEAMQEVTGERGI
VITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIGMMEFSLFGIPYTGADICGFFGDAEYE
MCIRWMQLGAFYPFSRNHNTAGTRRQDPVSWNSTFEGYARNVLLIRYALLPYLYTLMHKA
HTEGSTVIRPLLYEFTDDNTTWDIDHQFMLGPAILISPVLESDTFEIRAYFPRARWYKLL
TGSGNNSAGEWKTLEAPLDHINLHIRGGYILPWQVPGMNTYFSRRNFMGLTVALDNDGKA
EGQLFWDDGQSIDTYEKGNYFLATFIAEMNTLKIQILHNQYLSDTNPLKIGFIRILGLNY
TYVVQVIVHTTTICPALQKLMVLLRSECHRYQTIKTIKVTALPQLWNQVKPHFSRAVSDR
IATSVMELFIQLDAWNMTLEKLSKVIWVYGHPTLPTPNATSAFPASSFPPGFSTETVTSP
ALTTTSEVTTTFITLLPNTTTSLPTQPPSTNTSNVMPVTTTSTETSPVASTTSTTFPGIT
TLFPTTSYTNTSDIYPETISTPDTSPVVSTTNTTFPDITTPFPTTSSHTNTSDVFPETTP
TPVTSPVVSTTSTIFPGITTPFPTSPTTANTSDVIPVTTATPQTSTVDNTTSTTFFGTTT
PFPITSSHANTSAVFPETTPTPATSPVVNTTNTTFPSTTTPFPTTSSHTNTSDVFPETTT
APETSPVVNITNTTFPGIITPFPTSPTTANTSDVIPVTIATPQTSTIDNKTNTTFSGTTT
PFPTTSSHTNTSDVFPETTTTPETSPVVNITNTTFPGINTPFPTSSTIANSR
NT seq 6459 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacgagatgcagtgtttgaagctggtaatcgtcccagggacgcctgtcgatgg
cagcgtaaatgctgctggaagccagtggcagatcccaaagtccctgcatgcttcttccct
aggaactggggttatgaagtcaccagtgtccctacaaatacgagcacagggttaactgcc
aagttgaagaaattgtcatccccatctctttttggaaatgatattgctgatgccttattg
acagctgaataccaaacatccagtcgttttcattttaagatcactgatttcaatgagata
cgatatgaagtcccttatgaaaacatcaacctcgtaaatgggactgctgagaattccagt
ttgagctatgacatagaggtcatcaagaagccattcagcatccgagtactacggaagagc
aaccaaagagtcttgctggatactggcattgggccgctccaattcgaccagcagtacctg
cagctctctttccgactgcccagctctaacgtgtatggactcggggaacacgtgcatcag
caatacctccataacatgagctggaacacctggcccatctttaccagagacaccactccc
aggcagggcatgattaatctttatggagcacacacattcttcttgtgcctggaagatacc
agtggggcttcttttggagtatttctgatgaacagcaatgccatggaggtcacacttcag
cctgctcctgccattacttaccgcacaactgggggaattcttgacttttacatcttcttg
ggaaacacgccagagcaagtcgttcaggagtacctggaggttgttggtcgaccattcttg
ccttcttattggagccttggttttcagctcagccgcagggattatggtggcattgatggg
ctgagacaggttgtacagcgaaaccgtgatgctgagatcccatatgatgtgcaatactcg
gacatagactacatgaatggaagtagagatttcactattgatgaacaggcttacccccag
ctctcagattttgcaaaggacctacatgataatggacagaaatatgtaattattctgaat
cctggcatcatcagcaatactaatgacgaggtctacttcaatggaagcaagaacagagtc
tggatcatgagctccagaggctttgctactggggagggttatgcaggagagtcagtcttt
cccgactttaccaatccagcctctcttccatggtggacccagcaggtcactgaattttac
aaccgtctggagtttgatggtgtgtggattgaaatggatgaactagccacgctcccccca
gctcccaagtgcgagttaaataacttgaaccaccctcccttcactcccaattattctcgg
gccctggatgctgtcttctcttccaagaggaacttccttttatcacgttctacttttgct
gggtctggcaagtttgctggtcattggctgggaaacaatgcagccagctgggatgatctc
agatggtctatccccagtatccttgagtttaatctatttggcatccccctggtaggagcc
aacatctgtggctatgaaaacaatgtcacagaagaactttgcacaaggtggatgcaactt
ggagcattttacccactatccaggaatcacaatggtcctgagtacagagaccaggaccct
gctgcctttggccctaactctctgctattgcaatcatcgagacattatttgaacatccgc
tataccttactgccgtatctctacactctcttctaccgagctcatactctgggagagacc
gtagcaagacccctggtacatgaattctatcaggacccagccacatgggctgtacatgag
cagttcttatgggggcccggactcctcatcactcctgtgttgtatgaaggcaaggaggaa
gcgaaagcctatatcccagatgccatctggtatgactatgagacgggactggctgtccaa
tggagaaaacaatttatagacatgccactaccacgtgacaggataggacttcaccttcga
ggtggctacatatttcccattcaagaaccaaacataaccacagaggccagccggaagaat
cccttgggactcatcgttgccttggattataagcgagaagcaaagggccaactgtactgg
gatgatggtgtgtctaaaggcacagtgtctgaaaagaattaccttctctatgatttttct
gttacatctaatcatttacaggcaaaaattataaatggtaactatgtggatcccaataac
atcatgttcacagacatcagaatcttagggatggacaaagaaccaactgattgtaatgtt
ttatttaatggcaataagatctctacttcaacctgcaactacaatgcttccgcaaaggtg
ttgatcattagtaacctcacgggactgaaactgggacaggaattttccattgagtggaag
cttgtagtcaatgacctggagaaatttaactgcttccctgaggatcctgccgtatcagag
gaaaggtgcaagcagcgagggtgcctctgggagcaaacaactgctcctggagtgcctatc
tgtttctatgacaccattccccagtatgctgccagtaatattcagtaccagcccacaggc
attaccatggacctgaccctcctggaaaactcaacatctgcccaggcagcagcagctcca
agagttgtctctgatcctctttctggaaagatcaactctcttagactgagtgtgacttac
catacagaaaatatgctgcaggtcaagatttacagtaccagtaacaaaaggtatgaagtc
ccagtacctctgaacattccttcttcaccactgggctactctgagaactgcctgtatgat
gtaagtgttaagaccaacccatttggactccaaattcaacgtaaaagctccggtactgtg
atttgggatactcagctccctggcttcaccttcagtgagatgttcctttccatttcaact
cgtcttccctctcattacatctatggctttggggaaacagaccatacatctttgagaaga
aatatgagttggaacacatggggaatgtttgctcgggatgagccaccattgtacaagaaa
aattcctatggtgttcacccttattatatggcattggaagataatagtaatgctcatgga
gtgctcctgttgaacagcaatgccatggatgttacactccagcccacccctgccctgaca
taccgcaccataggagggattctggacttctatatggttttggggccaacacctgaactt
gtaactcagcagtacacccagttgattggtcggccagccatgcctccatactgggcctta
ggtttccagctgagtcgctatggataccagagtgatgctgaaattggcaatttgtattct
gcaatggttgcagcaagaattccttatgatgtgcagcatgtagacattgattacatggac
cggaagttggacttcaccctcagccccaactttcaaaatctcagtgtcctgattaatcaa
atgaagacaaatggcatgagatttattctcgttctggatccagctatttctggcaatgag
acacactatctcacattcactcgaggacaggaaaacaatgtgttcatcaaatggcctgat
tccaatgacatcgtctggggcaaggtgtggccagagttgcccaatgtaaatgtggatgga
tcccttgacctcgagactcaacttaagctatacagggcctatgttgcttttcctgacttc
ctgcgtagcagcacagcctcatggtggaagaaggagatagaagagctctattcaaatcct
cgggagccacagaagagtttgaagtttgatgggctgcggattgatatgaatgagccttca
aactttgtggatggagctgttgggggctgccgcagtgagattctcaataatccaccctac
atgcccgatttggaagccaggaatgtgggcttgagcagcaagactttatgcatggaaagc
gagcagatccttccagatggctcccgggtgcagcactatgatgtgcacagtctatatggg
tggtctcagaccagacccacctacgaagctatgcaggaggtgacaggagagagagggatc
gtcatcacccgctccacattcccctcttctggacgctggggaggacactggctgggagac
aacacagctgcctgggaccagctgcggaaatccatcattggtatgatggagttcagtctg
tttggaataccttatacaggagcagatatttgtgggttctttggagatgctgagtatgag
atgtgtatccgctggatgcaactgggagccttttatccattttccaggaaccacaacaca
gctggaactaggagacaagaccctgtgtcctggaattcaacttttgaaggctacgcaaga
aacgtgttgcttatcagatatgccctgctgccatatctgtatactctgatgcacaaagct
cacacagagggcagcactgtcatccgaccacttctctatgagttcacagacgacaataca
acatgggatatagaccaccagttcatgctgggcccagccatcctgatcagccctgttctg
gaaagtgatacatttgagatccgtgcttatttccctagagcccgttggtataaacttctt
acgggatctggcaacaattcagcaggtgagtggaaaacacttgaggctcctctggaccac
atcaatcttcacatcagaggaggctacatcctgccttggcaagtgcctggaatgaacact
tacttcagtcggcgaaattttatgggattgactgttgctttggataatgatgggaaggcc
gaaggtcaattgttttgggatgatggacaaagcatcgatacatatgaaaaaggaaactat
ttcttggctacctttatagcagaaatgaacaccttgaaaatccagattctgcataatcag
tatctgagtgacacaaatccactgaaaatcggattcattagaatcttgggtttaaattat
acttatgtggtgcaagttattgtacatacaacaaccatatgcccagccctgcaaaagtta
atggttcttttaagatcagagtgccatagatatcagactattaaaactattaaagtgaca
gctttgcctcagctctggaaccaagtgaaaccacatttttcaagagcggtttctgacaga
atagcaaccagtgtaatggaactatttattcaattggatgcatggaatatgaccctagaa
aaactgagtaaagttatttgggtttatggacatcctacacttcccacaccaaatgcaacc
agtgcatttcccgcaagctctttcccacctggatttagcactgaaactgtgaccagtcct
gctctcacaaccacatctgaagtaacaactactttcataaccctacttcctaatacaact
acatctctccctacacaacctccttccactaacactagcaatgtgatgcctgtcacaact
acatctactgagacaagtcctgttgccagtacaactagcaccacatttccgggcataact
acacttttccctacaacttcttatactaacactagtgatatatatcctgaaacaatttca
acccctgatacaagtcctgttgtcagtacaactaataccacatttcctgacataactaca
cctttccctacaacttcttctcatactaacactagtgatgtatttcctgaaacaactcca
acccctgtgacaagtcctgttgtcagtacaactagtactatatttcctggcataactaca
cctttccctacaagtcctactactgctaacactagtgatgtgattcctgtcacaaccgca
actcctcaaacaagtactgttgacaatacaactagcaccacattttttggcacaactaca
cctttccctataacttcttctcatgctaacactagtgctgtatttcctgaaacaactcca
acccctgcaacaagtcctgttgtcaatacaactaataccacatttcctagcacaactaca
cctttccctacaacttcttctcatactaacactagtgatgtatttcctgaaacaactaca
gcccctgagacaagtcctgttgtcaatataactaataccacatttcctggcataattaca
cctttccctacaagtcctactactgctaacactagtgatgtgattcctgtcacaattgca
actcctcaaacaagtactattgacaacaaaactaacaccacattttctggcacaactaca
cctttccctacaacttcttctcatactaacactagtgatgtatttcctgaaacaactaca
acccctgagacaagtcctgttgtcaatataactaataccacatttcctggcataaataca
cctttccctacaagtagtactattgctaactctaggtga

DBGET integrated database retrieval system