KEGG   Rattus norvegicus (rat): 312299Help
Entry
312299            CDS       T01003                                 

Gene name
Ezh2
Definition
enhancer of zeste 2 polycomb repressive complex 2 subunit (EC:2.1.1.43)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    312299 (Ezh2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     312299 (Ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q24
AA seq 746 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPDEREEKQKDLDDSRDDKETCPPRKFPADKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPV
PTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccggtttgttggcggaagcgtgtaaag
tcagagtacatgagactgagacagctcaagaggttcagaagagctgacgaagtaaagact
atgtttagttccaatcgtcagaaaattttggaaagaactgaaaccttaaatcaagaatgg
aagcagcgaaggatacagcctgtgcacatcatgacttctgtgagctcattacgcgggact
agggagtgttcagtgaccagtgacttggattttccagcacaagtcatcccgttaaagacc
ctaaatgctgtcgcatcggtgcccataatgtattcttggtctcccttacaacagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggggatgaagttctggat
caggatggcactttcattgaagaattaataaaaaattatgatggaaaagtgcatggagac
agagaatgtggatttataaatgatgaaatttttgtggagttggtaaatgctcttggtcaa
tataatgatgatgacgatgatgatgatggagacgatcctgatgaaagagaagaaaaacag
aaagatctagacgatagtcgagatgataaagaaacttgcccacctcggaaatttcctgct
gataaaatatttgaagccatttcctcaatgtttccagataagggcacagcagaagaactg
aaagaaaagtataaagaactcacggagcagcagctccccggtgctctacctcctgaatgt
accccaaacatcgatggaccaaatgccaaatctgttcagagggagcaaagtttacattca
tttcatacgctcttttgtcgacgatgttttaagtatgactgcttcctacatccctttcat
gcaacacccaacacatataagaggaagaacacagaaacagctctggacaacaagccttgt
ggaccacagtgttatcagcatctggagggagctaaggagtttgctgctgcccttactgct
gagcggataaagacaccacctaaacgtccagggggccgcagaagaggaagacttccgaat
aacagtagcagacccagcacccccaccatcagtgtgctggagtcaaaggatacagacagt
gacagagaagcagggactgaaaccgggggagagaacaacgataaagaagaagaagagaaa
aaagatgagacttccagttcctctgaagcaaattctcggtgtcaaacaccaataaagatg
aagccaaatattgaacctcctgagaatgtggagtggagtggtgctgaagcctccatgttt
agagtcctcattggtacttactacgataacttttgtgccattgctaggctaattgggacc
aaaacatgtagacaggtgtatgagtttagagtcaaagagtccagtatcatagcacctgtt
cccactgaggatgtggacactcctccaagaaagaagaaaagaaaacatcggttgtgggct
gcacactgcagaaagatccaactgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgaccatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttcctggatgc
cggtgcaaagcacaatgcaacaccaagcagtgtccgtgctacctggctgtccgagagtgt
gatcctgacctctgtctcacttgtggagctgctgaccactgggacagtaaaaatgtgtcc
tgcaagaactgtagcattcagcggggctctaaaaagcacttactgctggcaccgtctgat
gtggcaggctggggcatctttatcaaagatccagtacagaaaaatgaattcatctcagaa
tactgtggagagattatttctcaggatgaagcagacagaagagggaaagtgtatgacaaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggcaacaaaattcgttttgctaatcattcagtaaatccaaactgctatgcaaaagttatg
atggttaatggtgaccacaggataggcatctttgctaagagagctatccagactggtgaa
gagttgttctttgattacagatacagccaggctgatgccctgaagtatgtgggcatcgaa
cgagaaatggaaatcccttga

DBGET integrated database retrieval system