KEGG   Rattus norvegicus (rat): 312721Help
Entry
312721            CDS       T01003                                 

Gene name
Dyrk4, Rad51ap1
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     312721 (Dyrk4)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   312721 (Dyrk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
4q42
AA seq 649 aa AA seqDB search
MQLLPLPALTWTETKMDTNKARKRSLTTFPVLKARKKQSFTSVKGPTLPPDIYMVESKPL
VQLQKPSSKTKKLRSNRCSQKNPSTSSSAFPFVDTKGKKNTVNFPHIGNKTLPKGSTLYQ
ENQIHNQLLSSELKISEIPFSFSTKAXDTKVQDTKLHPELPKRHKVPFSHTEALKFFKNQ
LSPYEQSEILGYSELWFLGLDAKKLNVVPEKFSKTSFDDEHGSYVKVLHDHIAYRYEVLD
MIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNTHNVVH
MKDFFYFRNHLCITFELLGINLYELMKNNSFQGFSLSIVRRFTLSVLKCLQMLYVEKIIH
CDLKPENIVLYHRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMW
SLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPTHLIQTATRRQIFFDSKGLPKNIT
NNRGEKRYPNSKDLPMVVKTYDSSFLDFLRRCLVWEPSLRMTPDQALKHAWIHEPRKFKP
WPRPQIQRKPGVSSSSETSKDKTEEHQASKGTKDEATKETTDKLKDEPEKHPESSCKRQS
SIQHLANTVQLPNLAEASGKPEAVAGSETSEEQQCTSSPKSTNILPPIM
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcctcccacttcctgccctcacctggacagagactaaaatggatacgaacaag
gcaaggaaacgtagtttgacaaccttcccagttttgaaagcaagaaagaagcagagtttc
acctccgtgaagggtcccactcttcctcctgatatctacatggttgagagtaagcctttg
gttcaactccagaagccatcctccaagaccaagaagctgagatcaaaccgatgttcacaa
aagaatccaagtaccagcagcagtgcattcccttttgtggacacaaaggggaagaagaac
acagttaacttcccccacattggcaacaaaaccctaccaaaggggtccacattgtatcag
gaaaatcagattcataatcaactgctgtcctctgaactcaagatctcagaaatacctttt
agctttagcaccaaagcctaagacaccaaagtccaagacaccaagctccatccagaacta
ccaaagaggcacaaagtccccttttcccatacagaggccctaaagttttttaagaatcag
ctgtccccttatgaacaaagcgaaatcctgggctactcggagctgtggttcctagggctt
gatgccaagaagctcaacgtggttccggagaagttcagcaagacaagctttgatgacgag
cacggttcctatgtcaaggtcctgcatgaccacattgcctaccgatacgaggttctggat
atgatcgggaaagggtcctttggacaggtggccaagtgcttggatcacaaaaacaatgag
ttggtggccctgaaaatcataaggaacaaaaagagatttcaccatcaggctctggtggag
ctgaagatcctggaggccctcagaagaaaggacaaagacaacacccacaacgtagtccac
atgaaggacttcttctacttccggaatcacctctgtatcacctttgaactcctgggaatc
aacctgtatgagttgatgaagaataacagctttcaaggcttcagtctgtccatagttcgg
cgcttcaccctttctgttttgaaatgcttacaaatgctttatgtagagaaaatcatccac
tgtgacctcaagccggaaaatattgtgctgtaccaccggggccaagtcactgttaaagtt
attgactttgggtcaagctgctatgaacaccagaaagtttatacatacatccaaagccgg
ttctaccgatcccccgaggtgattctgggccacccctataacatggccattgatatgtgg
agcctgggctgtatcatggctgagctgtacaccggatacccactgttccctggggagaac
gaggtggagcagctggcttgcatcatggaggtgctgggcctgccacctacccacctcatc
cagacagccaccagaagacagatattcttcgattccaaaggtcttcccaaaaatataacc
aacaacagaggggaaaaaagatacccgaattccaaggacctcccgatggtggtgaaaacc
tatgactccagcttcctggactttctcagaaggtgtttggtgtgggagccttctctgcgc
atgacccctgaccaggccctcaagcatgcctggattcacgagccgaggaaattcaaacca
tggcccaggcctcagatccaaaggaagcctggtgtgagtagctcctctgagacaagcaag
gacaagactgaagagcaccaggccagcaaaggcacaaaagatgaggccaccaaagaaact
acagacaagttgaaagatgagcctgagaagcaccctgagagttcgtgcaaacggcagagc
tctatccagcacttagccaacacagtccagctgcctaatctagcagaagcttctggaaag
ccagaggctgttgctgggtcagagacgtccgaagaacaacaatgcacctcctcccccaag
agcacaaacattttaccacccatcatgtga

DBGET integrated database retrieval system