KEGG   Rattus norvegicus (rat): 312806Help
Entry
312806            CDS       T01003                                 

Gene name
Art4, ATR4
Definition
ADP-ribosyltransferase 4 (EC:2.4.2.31)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     312806 (Art4)
Cellular antigens [BR:rno04090]
 Proteins
  312806 (Art4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q43
AA seq 306 aa AA seqDB search
MALWFPGGQLTLLLLPLLLLLLWVQQTPAGSAEAALKVDVDLTPGSFDDQYRGCSKQVLE
ELNQGDYFVREIDTHKYYSRAWQKAHLTWLNQATSLPESMTPVHAVAILVFTLNLNVSSD
FAKAMTRASGSPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNGSPCYRVHHRMKDVNIE
ANVGSTVRFGQFLSASLLKEETQVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEV
VSKNCSLKGDLINLRSAGNVSRYNCQLLKASSKKCTPAPMVVLCLCLVSVLISSKSREHR
NLPAPF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtggtttccaggagggcagctcactctgctgctgctgccgctgctgctgctg
ttgctctgggtccagcagacaccggcggggagcgctgaggctgctcttaaggtcgacgtg
gacttgacaccgggttccttcgatgatcagtaccgaggctgtagcaaacaggtgctggag
gagctaaatcaaggagactatttcgtgagggagatagacactcataagtattactccagg
gcgtggcaaaaagcccacctaacctggctgaaccaggcaacgtccctccctgagagcatg
actcctgtgcacgctgtggccatcttggttttcaccttgaatctcaacgtgagctctgac
ttcgccaaggccatgaccagggcttcggggtctcctgggcagtacagacagtcattccac
ttcaagtatctgcactactacctcacctcagccatccagctgctgaggaaagagagctct
accaagaacggcagtccgtgttacagggtacaccacaggatgaaggacgtgaacatcgaa
gccaatgtgggttctaccgttcgatttggccagttcctctctgcctccctgctgaaggag
gagacacaggtgtctggaaaccaaacactgtttaccattttcacttgtctgggcgcctcc
gtgcaagacttctctctcaggaaggaagtcttgatccctccctatgagttatttgaagtc
gtgagtaagaactgcagcctcaaaggagatttgataaacttgcggtctgctgggaacgtg
agcaggtacaactgccagctgctgaaagcttccagcaagaagtgcacccctgctccaatg
gttgttctttgcctctgtttggtcagtgtccttatctcgtccaaaagcagagagcatagg
aatctaccggctcccttttaa

DBGET integrated database retrieval system