KEGG   Rattus norvegicus (rat): 313050Help
Entry
313050            CDS       T01003                                 

Gene name
Lck, Lck1, Lcktkr
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  
lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    313050 (Lck)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    313050 (Lck)
   04660 T cell receptor signaling pathway
    313050 (Lck)
   04658 Th1 and Th2 cell differentiation
    313050 (Lck)
   04659 Th17 cell differentiation
    313050 (Lck)
  Development
   04380 Osteoclast differentiation
    313050 (Lck)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    313050 (Lck)
  Infectious diseases
   05166 HTLV-I infection
    313050 (Lck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     313050 (Lck)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  Src family
   313050 (Lck)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    313050 (Lck)
Cell adhesion molecules and their ligands [BR:rno04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     313050 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
5q36
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKSTLPIRTGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLEKGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccccgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagagtacgctgcccatccggacc
ggctctgaagttcgggacccactggtcacctatgagggctccctcccaccagcctccccg
ctgcaagacaacctagttattgccctgcacagctatgagccctcccatgatggagacttg
ggctttgaaaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgaccactggccaagaaggcttcatccccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaaaaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcaccgcc
ggatccttttcactgtcagtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggactacacgatctggtccgccattacaccaacgcctctgatgggctgtgcacaaaattg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagagagacattgaagttggttgagcggctgggagctggccagttcggggaagtgtgg
atgggatactacaatggacacacgaaggtggcagtgaaaagtctgaagcaagggagtatg
tctcctgatgccttcctggcagaggctaacctcatgaagcagctgcagcacccgcggctc
gtccggctttatgcagtggtcacccaggagcccatctacattatcacagaatacatggag
aacgggagcctagtagatttcctcaagactccctcgggcatcaagttgaacgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagagcagaattac
atccatcgtgacctgcgggctgccaacatcctggtgtctgacacgctgagctgcaaaatt
gcagactttggcctggcacgtctgattgaggacaatgaatacacggcccgggagggggcc
aagtttcccattaagtggacagcaccagaagccattaactatgggacctttaccatcaag
tcagatgtgtggtccttcgggatcctgctgacagagatcgtcacccatggccggatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggaaaaaggctaccgaatggtg
cgacctgacaactgcccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggacaggcccacgtttgactaccttcggagcgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system