KEGG   Rattus norvegicus (rat): 313050Help
Entry
313050            CDS       T01003                                 

Gene name
Lck, Lck1, Lcktkr
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase (EC:2.7.10.2)
  KO
K05856  
lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    313050 (Lck)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    313050 (Lck)
   04660 T cell receptor signaling pathway
    313050 (Lck)
  Development
   04380 Osteoclast differentiation
    313050 (Lck)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    313050 (Lck)
  Infectious diseases
   05166 HTLV-I infection
    313050 (Lck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     313050 (Lck)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  Src family
   313050 (Lck)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    313050 (Lck)
Cell adhesion molecules and their ligands [BR:rno04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     313050 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKSTLPIRTGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLEKGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccccgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagagtacgctgcccatccggacc
ggctctgaagttcgggacccactggtcacctatgagggctccctcccaccagcctccccg
ctgcaagacaacctagttattgccctgcacagctatgagccctcccatgatggagacttg
ggctttgaaaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgaccactggccaagaaggcttcatccccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaaaaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcaccgcc
ggatccttttcactgtcagtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggactacacgatctggtccgccattacaccaacgcctctgatgggctgtgcacaaaattg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagagagacattgaagttggttgagcggctgggagctggccagttcggggaagtgtgg
atgggatactacaatggacacacgaaggtggcagtgaaaagtctgaagcaagggagtatg
tctcctgatgccttcctggcagaggctaacctcatgaagcagctgcagcacccgcggctc
gtccggctttatgcagtggtcacccaggagcccatctacattatcacagaatacatggag
aacgggagcctagtagatttcctcaagactccctcgggcatcaagttgaacgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagagcagaattac
atccatcgtgacctgcgggctgccaacatcctggtgtctgacacgctgagctgcaaaatt
gcagactttggcctggcacgtctgattgaggacaatgaatacacggcccgggagggggcc
aagtttcccattaagtggacagcaccagaagccattaactatgggacctttaccatcaag
tcagatgtgtggtccttcgggatcctgctgacagagatcgtcacccatggccggatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggaaaaaggctaccgaatggtg
cgacctgacaactgcccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggacaggcccacgtttgactaccttcggagcgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system