KEGG   Rattus norvegicus (rat): 313063Help
Entry
313063            CDS       T01003                                 

Gene name
Rad54b, Fsbp, RGD1306507
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rno03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q13
AA seq 888 aa AA seqDB search
MRRSAAPSQVRGNSSKKARFVPPGRSTTGVSKEISMSPEAKLVQGAHQSQGDAGVCSSNP
WLTEGSPVEMGDGARVDPLSPVHLASKEIIESKAQEEEASSLLKYFSVVWCKASKKKHKK
WEGDAILIVKGRSFILKDMEGKDIGRGMGYKFKELENVEEGQTLMLGGKEIEILGTVSAE
DFNSGKCFQAGSGSPAVPSSQAARKCFSNPFKSVCQSTQARRDRGNDWQNCKPRYDPYTP
NALVMPRPDKSHQWAFNRSCLPTVDVVIDPHLVRHLRPHQKDGVAFLYECVMGMRAVGKC
GAILADEMGLGKTLQCISLIWTLQCQGPYGGKPIVKRTLIVTPGSLVNNWRKEFQKWLGS
ERIKIFTVDQDHKVEEFINSAFHSVLIISYEMLLRSLDRIKTITFGLLICDEGHRLKNSG
IKTTAALSSLSCEKRVILTGTPVQNDLQEFFALVDFVNPGILGSLSSYRRIYEEPIVMSR
EPSASKEERELGERRTTELTRLTGCFILRRTQEVINKYLPPKIENVVFCRPGALQIELYR
KLLSSQSVRFCLQGLLGNSAHLICIGALKKLCNHPRLLFSFVKGKEFNSSRDENEERSLC
QGLLTVFPAGYNLLQLSESESGKLQVLVKLLAAISELRPTEKVILVSNYRQTLNLLEEVC
KCHGYACARLDGQTPVSQRQQIVDNFNSKYSTDFIFLLSSKAGGVGLNLIGGSHLILYDI
DWNPATDIQAMARVWRDGQKHPVHVYRLLTTGTIEEKIYQRQISKQGLSGAVVDLTRSSE
QIQFSVEELKNLFTLHENSHCVTHDLLDCECTGEKDHSDDASENPVTSRQCQLGPQKSSS
SRPLSMSQLKQWKHFSGDHLNLPDPFLERIRENVSFFFQNITNQAPAI
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgagacgttctgcagcaccaagccaggtgcggggaaattcctctaaaaaagcaagattt
gtacctccaggaagaagtactacaggtgtgagtaaggagatttcgatgagtccagaggca
aaactggttcagggcgcccaccagtcacaaggggatgcaggtgtgtgcagttccaatcct
tggctcactgagggaagccctgtggagatgggtgacggggctagagtagatccgctttct
ccagttcacttggcctctaaagaaatcatagagtccaaggcacaagaagaggaagctagc
agcttgcttaaatatttcagtgtcgtttggtgtaaagcttcaaagaaaaaacacaagaaa
tgggaaggcgatgctattcttattgtaaaaggaaggtcgttcatattgaaagatatggaa
ggaaaagatattggaagaggcatgggatataaattcaaagagcttgaaaatgtagaagaa
ggccaaacattgatgcttggtgggaaagaaatagagatcctgggtacagtctctgctgag
gacttcaatagtggcaagtgttttcaggctggaagcggaagtcctgccgtcccaagttct
caggctgccaggaaatgcttttctaaccctttcaagagtgtgtgtcagtcaactcaagca
aggagagacagagggaatgactggcaaaattgcaaacctcgctatgacccatacacacca
aatgcccttgttatgcctcgaccagacaagagtcaccagtgggcgtttaataggagctgc
cttcctactgtggatgtggtgatagaccctcaccttgtacgtcacctccgaccacaccag
aaagatggggtcgccttcctctatgagtgtgtgatgggaatgagagcagttggcaaatgt
ggtgccattcttgctgatgagatgggattagggaaaaccctgcagtgtatctcgctcatc
tggaccctccagtgtcaggggccttacgggggcaagccaatagtaaagaggacacttatt
gttacccctggaagcttggtgaataattggagaaaagaatttcaaaaatggctgggaagc
gaaaggatcaagatattcactgttgatcaggaccataaagtcgaggagtttatcaattct
gcatttcactctgttcttatcatcagttatgaaatgttacttcgttctctagatcgaatt
aagaccataacatttggccttctgatttgtgatgaggggcaccggttgaagaacagtggt
attaagacaacagcagccctttctagcctctcttgtgagaagagagtaattctgactggt
accccagttcagaatgatttgcaagagttttttgcattagttgattttgttaatccagga
atcttagggtctctgtcatcttataggaggatatatgaagagcccattgttatgtcaaga
gagccttctgcttccaaggaagagagagagttaggggagagaagaacaactgagctcaca
cgcctcactggatgtttcatccttagaagaactcaggaggtcatcaataaatatctcccc
cctaagatagagaacgtagtcttttgccgaccaggagcactgcagattgagctttaccga
aagctgctgagttctcaatctgtcaggttctgtctgcaaggccttttgggaaatagtgct
cacctcatttgcataggcgccctgaagaagctatgcaatcatcctcgcctcttgttcagc
tttgtgaagggtaaagaatttaactcgagtcgtgatgaaaatgaagaaaggagcctttgc
caaggcttgctgactgtgttccctgctggctacaacctgctgcagctctccgagagcgag
tcagggaaactacaggtgttagtaaagctcctggcggcgatctctgaacttcgtcccact
gaaaaagtgattttggtatccaactacagacaaaccttgaatcttttagaagaagtatgc
aagtgtcatggatatgcttgtgcaagacttgatggacaaacaccagtctctcaaagacag
caaattgttgataatttcaatagtaaatactctactgattttatttttttattaagttca
aaagctggtggtgtgggacttaatcttattggaggatctcacttaattctttatgatatt
gattggaacccagctactgacatccaggccatggctagagtgtggagagacggccagaaa
caccctgtccatgtttacagactcctgactacaggtacaatagaggaaaagatctatcaa
aggcagatcagtaagcaaggcctttctggggcggttgtagacctaaccagatcatccgaa
cagatccagttttcagtggaagagcttaaaaacttgttcacattacatgaaaattcacat
tgtgttactcatgacctgcttgactgtgagtgcacaggagagaaagatcactctgatgat
gcgtcggaaaaccctgtcacctctagacagtgtcagcttggccctcagaagtccagctcc
tcgagacctctgtccatgtcacagctgaagcagtggaaacatttttcaggagaccattta
aatctcccagacccatttctcgaaagaataagggaaaatgtgtccttctttttccagaat
ataaccaaccaagctcctgccatctaa

DBGET integrated database retrieval system