KEGG   Rattus norvegicus (rat): 313098Help
Entry
313098            CDS       T01003                                 

Gene name
Usp45
Definition
ubiquitin specific peptidase 45 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     313098 (Usp45)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   313098 (Usp45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q21
AA seq 594 aa AA seqDB search
MRVKDPSKDLPEKGKRSKRPLLPHDEDSSDDIAVGLTCQHISYAVSVNHVKKAVAETLWS
VCSECLKERRLCDGQPVLPSDVWLCLKCGFQGCGKNSESQHSLRHFKSSGAESHCVVISL
STWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHVFKTQTDAFSRIIKLCEEKREAGEIKK
GKKGCAVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNEIKEDGTKFKISLSSAPQLE
PLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQLCQKAPRFKGFQQQDSQELLH
HLLDAVRTEETKRIQASILKAFNNPTTKTADEETRKKVKAYGKEGVKMNFIDRIFIGELT
STVMCEECANISTMKDPFIDISLPIIEERVSKPVLLGKMSKCRSLQETDQDHNKGTVTVE
NTHPPRAAKKHSSPKDKAKRKAGGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVN
RHVDFPLTLDLAPFCAATCKNISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKL
SECITGRKTAPGLKEADSELGGHWVHVSDTYVQVVPESRALSAQAYLLFYERIL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaaaagatccatccaaagatctacctgagaaaggcaaaagaagtaaaagacca
ctgctacctcacgatgaagattcttcagatgacattgctgtaggtttaacatgccagcac
atcagttatgctgtcagtgtgaaccatgtgaagaaggcagtagctgagactctctggtca
gtttgttcagagtgtttgaaagagagaagactctgtgatggacagccggtacttccttcc
gatgtttggttgtgcctcaagtgcggttttcagggatgcggtaagaactcagaaagccag
cattcactgagacacttcaagagctctggggcggagtcccattgtgttgtcattagcctg
agcacatgggtcatatggtgttatgaatgtaatgaaaaattatcgacacattgcaacaag
aaagttttggctcagatagttgattttctccagaaacatgtttttaaaacacaaacagat
gcattttctagaatcataaaactttgtgaagaaaaacgtgaagcaggggaaataaagaag
gggaagaaaggctgtgctgtgccatctgtcaaaggaattacaaacttaggaaatacttgc
ttttttaatgccgtcatccagaacttggctcagacttacattctttttgaactgatgaac
gagataaaagaagatggcaccaaattcaagatttctctttcgtcagctccacagctggag
ccgttagtggtggaactttcaagccctggaccattgacttcagccttgttcctgtttctt
cacagcatgaaggaagctgaaaaaggaccactttctcctaaagttcttttcaatcagctc
tgtcagaaggctcctcgatttaaaggtttccagcaacaggacagccaggagcttctgcac
catttgttggatgcagtgaggacagaggagacaaagaggatacaagctagcattctaaaa
gcgttcaacaatccaactaccaagactgctgatgaggaaactagaaaaaaagtcaaagcc
tatggaaaggaaggcgtgaagatgaacttcatagatcggatcttcattggcgaattaact
agcacagtcatgtgtgaagaatgtgctaacatctctaccatgaaggatcccttcatagat
atttcacttcctatcatagaagaaagggtttcaaaacctgtacttttggggaaaatgagt
aaatgcagaagtttacaggaaacagaccaagatcataacaagggcaccgttacagtagaa
aatacccatccaccaagagctgccaagaagcattcctcacctaaagataaggcaaaaagg
aaggcaggaggagtttatactaatgccaggaagcaactactcatatctgctgttccagct
atcctaatccttcatcttaaaaggttccaccaggctggcttgagtcttcgtaaagtaaac
agacatgtagacttcccgcttacccttgacttagcaccgttctgtgctgctacctgtaag
aatataagtgtgggggagaaggttctctatggtctctacggtatagtggagcacagcggc
tcaatgagaggaggccactacactgcttacgtgaaggtgcgagtgccctccaggaagctg
tccgagtgcatcaccgggaggaagactgcaccaggtttgaaagaagctgatagtgaattg
ggaggccactgggtccatgtcagcgacacttatgtgcaagtggttccagaatcaagagca
ctgagtgcgcaagcttatctccttttttatgaaagaatattataa

DBGET integrated database retrieval system