KEGG   Rattus norvegicus (rat): 313121Help
Entry
313121            CDS       T01003                                 

Gene name
Map3k7, Tak1
Definition
(RefSeq) mitogen activated protein kinase kinase kinase 7 (EC:2.7.11.25)
  KO
K04427  
mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
AMPK signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Adherens junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Measles
Herpes simplex infection
Epstein-Barr virus infection
Module
Toll-like receptor signaling
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    313121 (Map3k7)
   04310 Wnt signaling pathway
    313121 (Map3k7)
   04064 NF-kappa B signaling pathway
    313121 (Map3k7)
   04668 TNF signaling pathway
    313121 (Map3k7)
   04152 AMPK signaling pathway
    313121 (Map3k7)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    313121 (Map3k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    313121 (Map3k7)
   04621 NOD-like receptor signaling pathway
    313121 (Map3k7)
   04622 RIG-I-like receptor signaling pathway
    313121 (Map3k7)
   04660 T cell receptor signaling pathway
    313121 (Map3k7)
  Development
   04380 Osteoclast differentiation
    313121 (Map3k7)
 Human Diseases
  Infectious diseases
   05162 Measles
    313121 (Map3k7)
   05168 Herpes simplex infection
    313121 (Map3k7)
   05169 Epstein-Barr virus infection
    313121 (Map3k7)
   05145 Toxoplasmosis
    313121 (Map3k7)
   05140 Leishmaniasis
    313121 (Map3k7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     313121 (Map3k7)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   313121 (Map3k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q21
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SDSGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATTAYTKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSLP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcatccgccgcctcgtcctcctcctcgtcttctgccagtgagatgatcgaa
gcgccatcgcaggtccttaacttcgaagagatcgactacaaggagatcgaggtggaagag
gttgttgggagaggagcttttggagtggtttgcaaagctaagtggagagcaaaagatgtt
gcaattaaacagattgaaagtgaatctgagaggaaggctttcatcgtggagctccggcag
ttgtcccgtgtgaaccatcctaatattgtaaagttgtatggagcctgcttgaatccagtc
tgtcttgtgatggagtatgctgaaggaggctcgttgtataatgtgctgcacggtgctgaa
ccattgccttattacactgctgctcatgccatgagctggtgtctacagtgttcccaagga
gtggcctacctgcacagcatgcagcccaaagctctcattcatagggacctcaagcctcca
aacttgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgt
gacatccagacacacatgaccaataataaagggagtgctgcttggatggcacccgaagtg
ttcgaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctttgg
gaggtgataacacgccggaaaccctttgatgagatcggtggcccagctttcagaatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaacttgcctaagcccattgag
agcttgatgacccgctgttggtctaaggacccttctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagctgatgagccgttacagtac
ccctgtcagtactctgatgaagggcagagcaactcagccaccagcacaggctcatttatg
gacatcgcttctacaaataccagtaataaaagtgacacaaatatggaacaagtccctgcc
acaaacgacactattaaacgcttggagtcaaaactgttgaaaaaccaggcaaagcaacag
agtgactctggacgcctgagtttgggagcctctcgagggagcagtgtggagagcttgccc
ccgacttctgagggcaagaggatgagtgctgacatgtctgaaatagaagcgaggatcgtg
gcgactacagcctataccaagcctaaacggggccaccgtaaaaccgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacgggcaaccaaggcgtagatccatc
caagacttgactgttactgggacagaacctggtcaggtgagcagcaggtcatccagccct
agtgtcagaatgatcactacctcaggaccaacctcagagaagccagctcgcagtcttcct
tggacccctgatgattccacagataccaatggctcggataactccatcccaatggcgtat
cttacactggatcaccagctgcagcctctagcaccatgcccaaactccaaagaatccatg
gcagtgttcgaacagcattgtaaaatggcacaggaatatatgaaagttcaaaccgaaatc
gcattgttactacagaggaagcaagaactagttgcagaattggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagacgaaaacaaaagc
ctttctacttattaccagcaatgcaaaaaacaactagaggtcatcagaagccagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system