KEGG   Rattus norvegicus (rat): 313375Help
Entry
313375            CDS       T01003                                 

Gene name
Cyp2j3, Cyp2j9
Definition
cytochrome P450, family 2, subfamily j, polypeptide 3 (EC:1.14.14.1)
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    313375 (Cyp2j3)
   00591 Linoleic acid metabolism
    313375 (Cyp2j3)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    313375 (Cyp2j3)
  Nervous system
   04726 Serotonergic synapse
    313375 (Cyp2j3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    313375 (Cyp2j3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     313375 (Cyp2j3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   313375 (Cyp2j3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
5q33
AA seq 502 aa AA seqDB search
MLVTAGSLLGAIWTVLHLRILLLAAVTFLFLADFLKHRRPKNYPPGPWRLPLVGCLFHLD
PKQPHLSLQQFVKKYGNVLSLDFANIPSVVVTGMPLIKEIFTQMEHNFLNRPVTLLRKHL
FNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLVEAIKDEGGLPFDP
HFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYL
PGSHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFLKEMAKYPDKTTTSFNEEN
LICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQGRQPNLADRDSMP
YTNAVIHEVQRIGNIIPFNVPREVAVDTYLAGFNLPKGTMILTNLTALHRDPKEWATPDT
FNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLS
LQFRMSVTISPVSHRLCAIPRL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcacagcgggttccctactaggggccatttggaccgtgctccatctccggatt
ttgctgctggctgctgtcacctttctgttcctggctgatttcctcaaacaccggcgcccc
aagaactacccgccagggccttggcgcctgcccttagtgggttgcttgttccatttggat
cctaaacagccacacctatcccttcagcagtttgtgaagaaatatgggaatgttttaagc
ctggattttgctaacattccttcagtggttgtaactggcatgcccttaatcaaagaaatc
tttactcaaatggagcacaattttttgaatcgccctgtcactcttctccgaaaacatctc
tttaacaaaaatggattgatcttctccagtggccagacatggaaggagcaaaggaggttt
gccctgatgactctgaggaactttggactaggaaagaagagcttagagcagcgaatacaa
gaggaagcctaccaccttgtggaggccataaaagatgagggaggactgccttttgaccct
cacttcaatatcaacaaagcagtctctaatatcatttgctctgtcacctttggggagcgc
tttgagtaccatgacagtcagtttcaggagatgctgaggctactggatgaggccatgtgt
ttggagtcatcaatgatgtgccagctctacaatatctttccaaggatacttcagtatctt
cctggatcacaccaaacacttttcagcaactggagaaaactgaagttgtttatttctgat
attattaagaatcaccggagagactgggatccagatgagccaagggacttcattgatgct
ttcctcaaggaaatggcaaagtacccagacaagactactacaagtttcaatgaagaaaac
ctcatctgcagtactttggatcttttctttgctggtacagagacaacatccactacactg
cgctgggctctgctctgcatggccctgtacccagaagtccaagaaaaaatgcaggctgag
attgacagagtgattggccaaggaagacagccaaacctggcagaccgagactccatgccc
tacaccaacgccgtcattcacgaggtgcagagaataggcaacatcatcccctttaatgtt
cccagggaagtggcagttgacacctatttggctggatttaacttgccaaagggtactatg
attctaaccaacttaactgcactgcacagggaccctaaagagtgggccaccccggacacc
ttcaacccagagcactttttggagaatggacagtttaagaagagagaatcctttctgcct
ttctcaatgggaaagcgagcatgtcttggagaacaactggccaggtccgagctgttcatt
tttatcacttctcttatccaaaaatttaccttcaagcccccggtcaacgagaagcttagt
ctgcaattcagaatgtccgtcaccatttccccagtcagtcaccgcctttgcgcaattcct
aggctgtga

DBGET integrated database retrieval system