KEGG   Rattus norvegicus (rat): 313375Help
Entry
313375            CDS       T01003                                 

Gene name
Cyp2j3, Cyp2j9
Definition
cytochrome P450, family 2, subfamily j, polypeptide 3 (EC:1.14.14.1)
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:rno04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:rno04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:rno04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
5q33
AA seq 502 aa AA seqDB search
MLVTAGSLLGAIWTVLHLRILLLAAVTFLFLADFLKHRRPKNYPPGPWRLPLVGCLFHLD
PKQPHLSLQQFVKKYGNVLSLDFANIPSVVVTGMPLIKEIFTQMEHNFLNRPVTLLRKHL
FNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRIQEEAYHLVEAIKDEGGLPFDP
HFNINKAVSNIICSVTFGERFEYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYL
PGSHQTLFSNWRKLKLFISDIIKNHRRDWDPDEPRDFIDAFLKEMAKYPDKTTTSFNEEN
LICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQGRQPNLADRDSMP
YTNAVIHEVQRIGNIIPFNVPREVAVDTYLAGFNLPKGTMILTNLTALHRDPKEWATPDT
FNPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFITSLIQKFTFKPPVNEKLS
LQFRMSVTISPVSHRLCAIPRL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcacagcgggttccctactaggggccatttggaccgtgctccatctccggatt
ttgctgctggctgctgtcacctttctgttcctggctgatttcctcaaacaccggcgcccc
aagaactacccgccagggccttggcgcctgcccttagtgggttgcttgttccatttggat
cctaaacagccacacctatcccttcagcagtttgtgaagaaatatgggaatgttttaagc
ctggattttgctaacattccttcagtggttgtaactggcatgcccttaatcaaagaaatc
tttactcaaatggagcacaattttttgaatcgccctgtcactcttctccgaaaacatctc
tttaacaaaaatggattgatcttctccagtggccagacatggaaggagcaaaggaggttt
gccctgatgactctgaggaactttggactaggaaagaagagcttagagcagcgaatacaa
gaggaagcctaccaccttgtggaggccataaaagatgagggaggactgccttttgaccct
cacttcaatatcaacaaagcagtctctaatatcatttgctctgtcacctttggggagcgc
tttgagtaccatgacagtcagtttcaggagatgctgaggctactggatgaggccatgtgt
ttggagtcatcaatgatgtgccagctctacaatatctttccaaggatacttcagtatctt
cctggatcacaccaaacacttttcagcaactggagaaaactgaagttgtttatttctgat
attattaagaatcaccggagagactgggatccagatgagccaagggacttcattgatgct
ttcctcaaggaaatggcaaagtacccagacaagactactacaagtttcaatgaagaaaac
ctcatctgcagtactttggatcttttctttgctggtacagagacaacatccactacactg
cgctgggctctgctctgcatggccctgtacccagaagtccaagaaaaaatgcaggctgag
attgacagagtgattggccaaggaagacagccaaacctggcagaccgagactccatgccc
tacaccaacgccgtcattcacgaggtgcagagaataggcaacatcatcccctttaatgtt
cccagggaagtggcagttgacacctatttggctggatttaacttgccaaagggtactatg
attctaaccaacttaactgcactgcacagggaccctaaagagtgggccaccccggacacc
ttcaacccagagcactttttggagaatggacagtttaagaagagagaatcctttctgcct
ttctcaatgggaaagcgagcatgtcttggagaacaactggccaggtccgagctgttcatt
tttatcacttctcttatccaaaaatttaccttcaagcccccggtcaacgagaagcttagt
ctgcaattcagaatgtccgtcaccatttccccagtcagtcaccgcctttgcgcaattcct
aggctgtga

DBGET integrated database retrieval system