KEGG   Rattus norvegicus (rat): 313387Help
Entry
313387            CDS       T01003                                 

Gene name
Usp1
Definition
ubiquitin specific peptidase 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:rno03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q33
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQEDEEKASEYRGSEIDQV
VPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKAGVKHLFNIISRKK
EALKDDSIQKDKGSCKEDPLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEIKNLTEFSSKVEEKSLQK
EETGGISSTETDSTRNLDDLKEQLPKGNWKRKSDGESGNMKKKVKLSRESQPLEENQRQT
RSKRKATGDTLEASPKIIPKCVSENESAKPSQKKSKVKINWLKPATKQPSILSKFCSLGK
ITTNQRSKGQPKVNEGDLEEDLEKDGRDNTVNGSGPASPGSSVTPVDSSEAKSINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGTAENYDDEVSIRVGGNAQPSKVLNKK
NVEGIGLLGGQKSKADYELCSKASNPEKVVGTPFTDSRNSETNDTNGTQESDRSKESSDQ
TGINVSGLENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgtcatacctagtgaaagtaatgggctttcaagaggcagtccatccaagaag
aacaggctgtctttgaagttttttcagaaaaaggaaactaaaagagccttagacttcact
gattctcaagaagatgaagaaaaagcttctgaatatagaggatctgagattgatcaagtt
gttcctgctgcacagtcctcaccagtaagctgtgagaagagagaaaacttgttaccgttt
gtgggactgaataaccttggcaacacttgttatctgaatagtattcttcaggtgttgtac
ttttgtcctggcttcaaggctggagtgaagcacttatttaatattatttcaaggaagaaa
gaagctctgaaggatgactctattcagaaggataagggaagctgcaaagaagatcctttg
gcaagttatgagcttatatgcagtttacagtccttaataatctcagttgaacagcttcaa
gctagttttctcttaaatccagaaaaatatacagatgaacttgcgacacagccaaggcga
ctgcttaacaccctgagggaactcaaccctatgtatgaaggctatctccagcacgatgca
caggaagtgctacagtgtattctgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaaataaaaaacttgactgaattttccagcaaggttgaagaaaaatctcttcagaaa
gaggagacaggtgggattagcagcacagagactgacagtacgaggaatctggacgacctc
aaagaacaactcccaaaagggaactggaaaagaaagagtgacggagaatcggggaacatg
aagaaaaaggttaaactgtccagggaatcccagccattggaagaaaaccagagacaaacc
agatcgaaaagaaaagctaccggagacacactagaggcttctcctaaaatcatccccaag
tgtgtttctgaaaatgagagtgcaaagccctcacagaagaaatccaaagttaaaataaat
tggttaaagccggccactaagcagcccagcattctttccaagttctgtagtcttgggaaa
ataacaaccaaccagcgctccaaagggcaacctaaagtaaacgagggtgaccttgaggag
gatttggagaaggatggacgcgacaacacagttaatggtagtggacccgcatctccagga
agtagcgtcacacctgtggacagtagtgaagctaagtccataaacaaaggtgcagagcag
attggttttgaactagtagagaaattgtttcaaggtcagctagtactgaggactcgttgt
ttggaatgtgaaagcttaacagaaagaagagaagactttcaggatattagtgtcccggta
caagaagatgaactttctaaagtcgaggagagctctgagatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagagaattgtagga
gaggataaatatttctgtgaaaattgccatcattatacggaagcagagcgaagtctcttg
tttgataaaatgcctgaagttatcactattcatctgaagtgctttgctgctagtggcttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttattgacacctctt
aaactgtcactagaagaatggagcacaaagccgactaatgacagctatggattatttgct
gttgtgatgcacagtggcattactattagtagtgggcactatactgcatctgttaaagtc
actgaccttaacagtctagaactagataagggcaattttgtggttgaccagatgtgtgag
ataggtaagccagagccactgaatgaggaggaagcaagggggacggctgaaaattatgac
gacgaagtatcaattagagttggtggtaatgcccagccaagtaaagttttgaacaaaaaa
aatgtagaaggtattggacttcttggaggacagaagagcaaagcagattatgagctgtgc
agcaaagcatctaatcctgagaaagttgtcgggacaccattcactgacagtagaaattct
gaaactaatgatactaacgggacccaggaatctgacaggagcaaggagtccagtgaccaa
acaggcattaacgtgagtggactggagaacaaaatttcctatgtagtgcaaagcttaaag
gagtacgaggggaagtggttgctctttgatgactctgaagtaaaagttacagaagagaaa
gactttctgaattctctttccccttctacatctcctacatctactccctacttgctattt
tataaaaaactatag

DBGET integrated database retrieval system