KEGG   Rattus norvegicus (rat): 313387Help
Entry
313387            CDS       T01003                                 

Gene name
Usp1
Definition
ubiquitin specific peptidase 1 (EC:3.4.19.12)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    313387 (Usp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     313387 (Usp1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   313387 (Usp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q33
AA seq 784 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQEDEEKASEYRGSEIDQV
VPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKAGVKHLFNIISRKK
EALKDDSIQKDKGSCKEDPLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEIKNLTEFSSKVEEKSLQK
EETGGISSTETDSTRNLDDLKEQLPKGNWKRKSDGESGNMKKKVKLSRESQPLEENQRQT
RSKRKATGDTLEASPKIIPKCVSENESAKPSQKKSKVKINWLKPATKQPSILSKFCSLGK
ITTNQRSKGQPKVNEGDLEEDLEKDGRDNTVNGSGPASPGSSVTPVDSSEAKSINKGAEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGTAENYDDEVSIRVGGNAQPSKVLNKK
NVEGIGLLGGQKSKADYELCSKASNPEKVVGTPFTDSRNSETNDTNGTQESDRSKESSDQ
TGINVSGLENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLLF
YKKL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgtcatacctagtgaaagtaatgggctttcaagaggcagtccatccaagaag
aacaggctgtctttgaagttttttcagaaaaaggaaactaaaagagccttagacttcact
gattctcaagaagatgaagaaaaagcttctgaatatagaggatctgagattgatcaagtt
gttcctgctgcacagtcctcaccagtaagctgtgagaagagagaaaacttgttaccgttt
gtgggactgaataaccttggcaacacttgttatctgaatagtattcttcaggtgttgtac
ttttgtcctggcttcaaggctggagtgaagcacttatttaatattatttcaaggaagaaa
gaagctctgaaggatgactctattcagaaggataagggaagctgcaaagaagatcctttg
gcaagttatgagcttatatgcagtttacagtccttaataatctcagttgaacagcttcaa
gctagttttctcttaaatccagaaaaatatacagatgaacttgcgacacagccaaggcga
ctgcttaacaccctgagggaactcaaccctatgtatgaaggctatctccagcacgatgca
caggaagtgctacagtgtattctgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaaataaaaaacttgactgaattttccagcaaggttgaagaaaaatctcttcagaaa
gaggagacaggtgggattagcagcacagagactgacagtacgaggaatctggacgacctc
aaagaacaactcccaaaagggaactggaaaagaaagagtgacggagaatcggggaacatg
aagaaaaaggttaaactgtccagggaatcccagccattggaagaaaaccagagacaaacc
agatcgaaaagaaaagctaccggagacacactagaggcttctcctaaaatcatccccaag
tgtgtttctgaaaatgagagtgcaaagccctcacagaagaaatccaaagttaaaataaat
tggttaaagccggccactaagcagcccagcattctttccaagttctgtagtcttgggaaa
ataacaaccaaccagcgctccaaagggcaacctaaagtaaacgagggtgaccttgaggag
gatttggagaaggatggacgcgacaacacagttaatggtagtggacccgcatctccagga
agtagcgtcacacctgtggacagtagtgaagctaagtccataaacaaaggtgcagagcag
attggttttgaactagtagagaaattgtttcaaggtcagctagtactgaggactcgttgt
ttggaatgtgaaagcttaacagaaagaagagaagactttcaggatattagtgtcccggta
caagaagatgaactttctaaagtcgaggagagctctgagatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacagtttgcttcagtggagagaattgtagga
gaggataaatatttctgtgaaaattgccatcattatacggaagcagagcgaagtctcttg
tttgataaaatgcctgaagttatcactattcatctgaagtgctttgctgctagtggcttg
gagtttgattgttatggtggtggactttccaagatcaacactcctttattgacacctctt
aaactgtcactagaagaatggagcacaaagccgactaatgacagctatggattatttgct
gttgtgatgcacagtggcattactattagtagtgggcactatactgcatctgttaaagtc
actgaccttaacagtctagaactagataagggcaattttgtggttgaccagatgtgtgag
ataggtaagccagagccactgaatgaggaggaagcaagggggacggctgaaaattatgac
gacgaagtatcaattagagttggtggtaatgcccagccaagtaaagttttgaacaaaaaa
aatgtagaaggtattggacttcttggaggacagaagagcaaagcagattatgagctgtgc
agcaaagcatctaatcctgagaaagttgtcgggacaccattcactgacagtagaaattct
gaaactaatgatactaacgggacccaggaatctgacaggagcaaggagtccagtgaccaa
acaggcattaacgtgagtggactggagaacaaaatttcctatgtagtgcaaagcttaaag
gagtacgaggggaagtggttgctctttgatgactctgaagtaaaagttacagaagagaaa
gactttctgaattctctttccccttctacatctcctacatctactccctacttgctattt
tataaaaaactatag

DBGET integrated database retrieval system