KEGG   Rattus norvegicus (rat): 313843Help
Entry
313843            CDS       T01003                                 

Gene name
Galm
Definition
galactose mutarotase (aldose 1-epimerase) (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rno00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rno00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q11
AA seq 342 aa AA seqDB search
MVSVTRTVFGELPSGGGAVEKFQLRSDQLNVDIISWGCTITALQVKDRQGKASDVVLGFA
ELEGYLQKQPYFGAVVGRVANRIAKGRFTVDGKEYHLPINREPNSLHGGFRGFDKVLWTP
QVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPDIYDHEVTIAADAYLPVDETLIPTGVIAPVEGTAFDLRKPVELGKHLQSYHIH
GFDHNFCLKESKEKKFCARVHHAASGRILEVYTTQPGVQFYTGNFLDGTLKGKSGEVYPK
HSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgaccagaaccgtgtttggagagctgccctcggggggaggggcagtggag
aagttccagcttcggtcagaccagctgaatgtggacatcatctcctggggctgcacgatc
actgctctgcaggtcaaagacaggcaggggaaagcctcagacgtggtgcttggctttgcc
gagttggaaggttacctccagaagcagccctacttcggagcagtggttgggagggtagcc
aaccgaattgccaaaggaaggttcacagtagatgggaaggagtaccacctgcccattaac
agagagcccaacagtctccatggaggattcagaggatttgataaggtcctctggactcct
caggtgctgtccaacggcgtccagttctctcgagtcagtccagatggtgaggaaggctac
cctggagagttgaaagtctgggtgacatataccctggatggcggagagcttgtagtcaac
tacagagcccaggccagccagaccactccagttaatctcaccaaccattcttattttaac
ctagcaggccagggctccccagatatatatgaccacgaagtcaccattgccgcagatgca
tacttgcctgtggatgaaactctgattccaacaggagtcattgctccggtggaaggaact
gctttcgacctgagaaagccagtggagctcgggaaacacctgcagagttaccacatccat
ggtttcgaccataatttctgtctgaaggagtccaaagaaaagaagttttgtgcaagggtg
catcacgctgcaagtgggaggatcctggaagtgtacaccacccaacctggcgtccagttc
tacacaggaaacttcttggatggtaccctgaagggcaagagtggagaggtctatcccaag
cactctggtttctgcctcgagacccagaactggcctgatgcagtcaaccagccccagttc
cctccgatactgctgaggcctggagaggagtacaaccacaccacctggttcaagttctcc
gttgcttaa

DBGET integrated database retrieval system