KEGG   Rattus norvegicus (rat): 314360Help
Entry
314360            CDS       T01003                                 

Gene name
Galc
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
rno  Rattus norvegicus (rat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    314360 (Galc)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    314360 (Galc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     314360 (Galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q32
AA seq 668 aa AA seqDB search
MTAAAGSASRVAVPLLLCAMLAPSGAYELDDSDGLGLEFDGIGAVSGGGATSRLLVNYPE
PYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKE
AKKRNPNIILMGLPWSFPGWLGKGFSWPYVNLQLTAFYIVRWILGAKHYHDLDIDYIGIW
NERPFDANYIKELRKMLDYEGLQRVRIIASDNLWEPISSSVLLDQELWKVVDVIGAHYPG
TYTVWNAKMSGKKLWSSEDFSTVNSNVGAGCWGRILNQNYINGNMTATIAWNLVASYYEE
LPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDG
LGNFTIIVETMSRQHSMCIRPYLPYYNVSRQLATFILKGSLKEIQELQVWYTKLGTTPEK
LHFKQLETLWLLDGSGSFSLELEEDEMFTLTTLTTGHKGSYRPPPKSQPFPTSYKDDFNV
EYPLFSEAPNFADQTGVFEYYTNNEDLEHRFTLRQVLNQRPITWAADASSTISVIGDHHW
SNMTVQCDVYIETPRTGGVFIAGRVNKGGILIRTASGVFFWIFANGSYRVTADLGGWITY
ASGHADVTAKRWYTLTLGIKGYLASGMLNGKILWENVPVKYPGHGWAAIGTHTFEFAQFD
NFHVEAAR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccgcgggctcggcgagccgtgtcgcggtgcccttgttgttgtgcgcgatg
ctggcgcccagcggcgcctacgagctagacgactccgacgggctgggcctggagttcgat
ggcatcggcgcagtcagcggcggcggggcaacctcccggcttctagtaaattacccagag
ccctatcgttctgaaatactggattatctatttaagccaaacttcggtgcctctctgcat
attctaaaagtggaaataggtggcgatggacaaacaacagacggcactgaaccctcccac
atgcactatgagctagatgagaattatttccgaggctatgagtggtggctaatgaaggaa
gctaagaagaggaacccaaatattatacttatggggttgccatggtcattccctggatgg
ctgggcaaaggcttcagttggccttatgtaaatcttcagctgactgccttctatattgtg
agatggattttgggtgccaagcattatcatgacctggacattgattatattgggatatgg
aatgaaaggccgtttgatgccaactatataaaggaattaagaaaaatgcttgattatgaa
ggtctccagcgagtgagaatcatagcaagtgataatctctgggagccaatttcctcttct
gtgctgcttgaccaggagctctggaaggtggttgatgttataggagctcattatcccgga
acctacacagtctggaatgcaaagatgtcagggaagaagctttggtcgtcggaagacttt
agcactgtcaacagtaatgttggcgcaggctgttggggtcgcatattgaaccagaattac
atcaacggcaatatgaccgccacaattgcttggaatttggtggctagttactatgaagaa
ttgccctatggacgaagtggattgatgacagcccaggagccgtggagtggacattatgta
gtagcatctcctatctgggtatcagctcatacaactcaatttactcaaccaggctggtat
tacctgaagacagttggccatctagagaaaggaggaagctatgtagctctgactgatggc
ttggggaatttcaccatcatcgttgaaactatgagtcgtcaacattctatgtgtatacgg
ccatatctaccgtattataatgtctcacgtcagctggccaccttcattctaaaggggtct
ttgaaagaaatacaagagctgcaggtgtggtacaccaagcttggaacaacaccagagaaa
cttcattttaaacaactggaaactctatggctccttgacggcagcggcagtttctcactg
gaactggaggaggatgagatgttcacactcaccactctgaccacagggcacaaaggcagc
taccgtccccctcccaagtcacagcccttcccaaccagctataaggatgatttcaacgtt
gagtacccattatttagtgaagctccgaattttgctgatcagaccggcgtgttcgagtac
tacacgaataacgaagaccttgagcatcgcttcacactgcgccaagttctcaaccaacga
cctattacctgggccgcggatgcctccagcacgatcagtgtcataggcgatcaccactgg
agcaacatgactgtgcagtgtgatgtttacatagagactcctcggactggcggtgtgttc
attgctggaagagtgaataaaggtggtatcttgatcagaactgcttcaggagttttcttc
tggatttttgcaaatggctcttacagagttacagccgacctgggtgggtggataacatat
gcttcaggacatgctgacgttacagcaaagcgatggtatacactcaccttaggcattaag
ggttatctcgcctctggtatgttgaacggcaagatcctgtgggaaaatgtgcccgtgaaa
tacccagggcatggctgggctgcgatcggaacgcataccttcgagtttgcgcagtttgac
aactttcatgtggaagctgctcgctaa

DBGET integrated database retrieval system