KEGG   Rattus norvegicus (rat): 314431Help
Entry
314431            CDS       T01003                                 

Gene name
Spaca5
Definition
sperm acrosome associated 5 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     314431 (Spaca5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
X
AA seq 160 aa AA seqDB search
MQFCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVS
SHKSMKAWDSWTRHCAGHDLSEWLKGCDVPLKADSNYDDW
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctgcagtactgtggtggtgatcttggccacactgttgcttgccacagtggat
gccaagatttatgaacgctgtgagctggcaaggaagctggagaaagctggcctcaatggc
ttcaaaggctacactgttggagactggctgtgtgtggcacactatgaaagtggttttgac
acctcttttgtggaccacaatccagatggcagcagtgaatatggcattttccagttgaac
tctgcttggtggtgtaataatggcatcacacccactcagaacctctgccacatggattgt
aatgacctactcaaccgccatattctggatgatatcatgtgtgccaagagggttgtatcc
tcacataagagtatgaaggcctgggattcctggacccggcactgtgctggtcatgattta
tctgaatggctcaaggggtgtgatgtgcctctgaaagctgactcaaactatgatgactgg
tga

DBGET integrated database retrieval system