KEGG   Rattus norvegicus (rat): 314621Help
Entry
314621            CDS       T01003                                 

Gene name
Stk11, Lkb1
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  
serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
FoxO signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Tight junction
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    314621 (Stk11)
   04151 PI3K-Akt signaling pathway
    314621 (Stk11)
   04152 AMPK signaling pathway
    314621 (Stk11)
   04150 mTOR signaling pathway
    314621 (Stk11)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    314621 (Stk11)
  Cellular community - eukaryotes
   04530 Tight junction
    314621 (Stk11)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    314621 (Stk11)
  Aging
   04211 Longevity regulating pathway - mammal
    314621 (Stk11)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     314621 (Stk11)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   314621 (Stk11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
7q11
AA seq 436 aa AA seqDB search
MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPG
NLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAPPLSDLLRGMLEYEPAKRFSI
RQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEDEDLFDIE
DGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARK
VCSSNKIRRLSACKQQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggctgacccccagccgttgggcctgttccccgagggcgagctaatgtcggtg
ggcatggacaccttcatccaccgcatcgactccaccgaggtgatctaccagccgcgccgc
aagcgcgccaagctcatcggcaagtacctgatgggggacctgctcggggagggctcgtac
ggcaaggtgaaggaggtgctggactccgagaccttatgccgcagggcggtcaagatcctc
aagaagaaaaagctgcgcaggatccccaatggcgaggccaacgtcaagaaggagatccag
ctgctgcggcggctgcggcatcggaatgtgatccagcttgtggatgtgctgtacaatgag
gagaagcagaagatgtatatggtgatggagtactgcgtgtgtggcatgcaggagatgctg
gacagtgtgccagagaagcgcttccccgtgtgccaagctcatgggtacttccgccagctg
attgacggcctggagtacctacacagccagggcattgttcacaaggacatcaagccgggc
aacctgctcctcaccaccaatggcacactcaagatctccgacctcggtgttgccgaggcc
ttgcaccctttcgctgtggatgacacctgccggaccagccagggctccccagccttccag
cctccagagattgccaatggactggacaccttttcaggtttcaaggtggacatctggtca
gctggggtcacactctacaacatcaccacgggcctgtacccatttgagggggacaatatc
tacaagctctttgagaacatcgggagaggggacttcaccatcccttgtgactgcgctcca
ccactctctgacctactccgagggatgttggagtacgagccagccaagaggttctccatc
cgacagattagacagcacagctggttccggaagaaacacccgctggccgaggctcttgtg
cctatccccccaagtccagacactaaggaccgctggcgcagcatgaccgtagtgccctac
ctggaggacctgcatggccgtgcagaggaggaggaggacgaggacttgtttgacattgag
gacggcatcatctatacccaggacttcacagtgcctggacaggtcctggaagaggaagtg
ggtcagaatggacagagccacagcctgcccaaggctgtttgtgtgaatggcacagagccc
cagctcagcagcaaggtgaagccagaaggccggcctggcgctgccaaccctgcacgcaag
gtgtgctccagcaacaagatccgccggctctcggcctgcaagcagcagtga

DBGET integrated database retrieval system