KEGG   Rattus norvegicus (rat): 314621Help
Entry
314621            CDS       T01003                                 

Gene name
Stk11, Lkb1
Definition
(RefSeq) serine/threonine kinase 11 (EC:2.7.11.1)
  KO
K07298  
serine/threonine-protein kinase 11
Organism
rno  Rattus norvegicus (rat)
Pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    314621 (Stk11)
   04151 PI3K-Akt signaling pathway
    314621 (Stk11)
   04152 AMPK signaling pathway
    314621 (Stk11)
   04150 mTOR signaling pathway
    314621 (Stk11)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    314621 (Stk11)
  Aging
   04211 Longevity regulating pathway - mammal
    314621 (Stk11)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   314621 (Stk11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q11
AA seq 436 aa AA seqDB search
MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPG
NLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAPPLSDLLRGMLEYEPAKRFSI
RQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEDEDLFDIE
DGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARK
VCSSNKIRRLSACKQQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggctgacccccagccgttgggcctgttccccgagggcgagctaatgtcggtg
ggcatggacaccttcatccaccgcatcgactccaccgaggtgatctaccagccgcgccgc
aagcgcgccaagctcatcggcaagtacctgatgggggacctgctcggggagggctcgtac
ggcaaggtgaaggaggtgctggactccgagaccttatgccgcagggcggtcaagatcctc
aagaagaaaaagctgcgcaggatccccaatggcgaggccaacgtcaagaaggagatccag
ctgctgcggcggctgcggcatcggaatgtgatccagcttgtggatgtgctgtacaatgag
gagaagcagaagatgtatatggtgatggagtactgcgtgtgtggcatgcaggagatgctg
gacagtgtgccagagaagcgcttccccgtgtgccaagctcatgggtacttccgccagctg
attgacggcctggagtacctacacagccagggcattgttcacaaggacatcaagccgggc
aacctgctcctcaccaccaatggcacactcaagatctccgacctcggtgttgccgaggcc
ttgcaccctttcgctgtggatgacacctgccggaccagccagggctccccagccttccag
cctccagagattgccaatggactggacaccttttcaggtttcaaggtggacatctggtca
gctggggtcacactctacaacatcaccacgggcctgtacccatttgagggggacaatatc
tacaagctctttgagaacatcgggagaggggacttcaccatcccttgtgactgcgctcca
ccactctctgacctactccgagggatgttggagtacgagccagccaagaggttctccatc
cgacagattagacagcacagctggttccggaagaaacacccgctggccgaggctcttgtg
cctatccccccaagtccagacactaaggaccgctggcgcagcatgaccgtagtgccctac
ctggaggacctgcatggccgtgcagaggaggaggaggacgaggacttgtttgacattgag
gacggcatcatctatacccaggacttcacagtgcctggacaggtcctggaagaggaagtg
ggtcagaatggacagagccacagcctgcccaaggctgtttgtgtgaatggcacagagccc
cagctcagcagcaaggtgaagccagaaggccggcctggcgctgccaaccctgcacgcaag
gtgtgctccagcaacaagatccgccggctctcggcctgcaagcagcagtga

DBGET integrated database retrieval system