KEGG   Rattus norvegicus (rat): 314746Help
Entry
314746            CDS       T01003                                 

Gene name
Usp44
Definition
(RefSeq) ubiquitin specific peptidase 44 (EC:3.4.19.12)
  KO
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     314746 (Usp44)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   314746 (Usp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q13
AA seq 481 aa AA seqDB search
MDRCKHIEQLQLAQGHSILNPQKWFCMVCNTTESIWACLSCSHVACGQYIQEHALKHFEE
SSHPVAFEVNDMYVFCYLCNDYVLNDNTAGDLKSLRSTLSAIKGKSYPCVVQSDSVLQPV
NAQADSYSLHDSTQSLPGSEDPMCTALWHRRRALMGKTFRTWFEQSPIGRKRQEQTQEKT
VAKREVKRRQQELEQQMKAELECTPPRKSLRLQGLSEAATVEILPVQAPPPPPASPAKEK
ALALPPSEDGKLKRVSDSLIKRRPAVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFL
KLDLNQWLAVAASDKARSYKHSAVTDAATAAAHQLNEGQEKEKGFACSRHPGLSSGLSGG
ASKGRNMELIQPREPSSPYSSLCHELHTLFQVMWSGEWALVSPFAMLHSVWKLIPAFRGY
AQQDAQEFLCELLDKIQRELETTGTKLPALIPTSQRRLIEQVLNVVNNIFHGQLLSQVWI
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggataggtgcaagcacattgagcagctgcagcttgctcaaggacattccatcctcaac
cctcagaaatggttctgcatggtctgcaatacaacggagtccatttgggcttgcctcagc
tgttcccacgtcgcctgtgggcagtatatccaagagcacgcactgaagcactttgaagaa
agcagccatcccgtggcctttgaggtgaatgacatgtatgttttttgttatctttgtaac
gattatgtcctaaacgataacacagccggagatctgaagtcactacgaagtacactaagt
gcaatcaaaggtaaaagttacccttgtgtggttcagagtgactcggtcttacagcctgtg
aatgcgcaggccgattcttactccctacacgacagcacccagtctctgcctggaagtgaa
gatccgatgtgcactgccctctggcacaggagacgtgcgctcatgggaaaaacctttcga
acttggtttgaacagtcaccgattggaaggaaaaggcaagagcaaactcaggagaaaacg
gtagccaagagagaggtgaagagaaggcagcaggagttagaacagcagatgaaagctgag
ctggaatgcactcctccgcgaaagagtttacgcttacaaggcctctccgaggcggccacg
gtcgaaatccttccggtgcaggcaccgccgccacctccagcgtccccagcgaaggagaaa
gccttagcgctacctccctcggaagacgggaaacttaaaagagtaagtgactccttaatc
aaacgaaggcccgcggtaactcctggtgtaaccggactgagaaatttaggaaatacttgc
tatatgaattctgttcttcaagtgttgagtcatttactcatttttcgacaatgtttttta
aagcttgacctgaaccaatggctggctgtggctgccagcgataaagcccgatcctataag
cactcagccgtcacggatgccgcgacagcggcggcacatcagctgaacgaagggcaagag
aaggagaaaggcttcgcgtgctccagacacccgggtttatcttcaggcctaagcggagga
gcctccaaaggtcggaacatggagctcattcagccaagggagcccagttccccgtacagt
tctctctgccatgaattgcacaccctgttccaagtcatgtggtccggagagtgggccctg
gtctcgccgtttgccatgcttcactcagtgtggaagctgatccctgctttccgtggttac
gcccagcaagatgcgcaggaatttctttgtgaacttctggataagatacagcgagaacta
gagacaaccggaaccaaattaccagctctcatccccacctcccaaaggaggctcattgag
caagttctgaacgtcgtaaataacatttttcacggacaactacttagtcaggtatggatt
tcttaa

DBGET integrated database retrieval system