KEGG   Rattus norvegicus (rat): 314764Help
Entry
314764            CDS       T01003                                 

Gene name
Eea1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    314764 (Eea1)
   04145 Phagosome
    314764 (Eea1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    314764 (Eea1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
7q13
AA seq 1411 aa AA seqDB search
MFRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
QAVHDAGNDSGHGGEASLALTRDDIALLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKSDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EEKGLRAAAEQKATHLTEELSKQTTVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSEHANSEATINQLRSELAKGPQEVAVYVQEIQKLKGSVNEL
TQKSQTLMEKLQKKDLDYTHLEEKHNEEALSRKNTQAALHQRDLDCQQLQARLTASEGSL
QRIQGELREKGEAAQKLKEELREVETKHQHLKVEFKQLQQQREEKEQHGLQLQGEVSQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLEKSKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHALQQQLTQLMEKLKNQSESHKQAEENLHD
QVQEQKAHLRAAQDRVLSLETSVSELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKVSAQLDQVTAKFQEKQEHCTQLESHLKDYKEKHLS
LEQKAEDLEGQIKKLEANNLEVKASREQAVQSLQQQRQLSTDLELRNAELRKQLQEQKEV
VSHTKLDLQNKSEALENIKQTLTKKEEEKVVLKQEFEKLSQDSEAQHKELSDRMQAAITE
LMVMTAQKDALLAELSTTKGKLSKVSDSLQTSRSEFEKESQKGKAAVLDLEKACKELKHQ
LQQQTESALKEQSELKKSLEKERETSQQLMIELNSVKGEVTQAQNTLKQKEKEEQQLQGN
INQLKQATEQKKKQMEALQGELKNVTSQKAQLESKLQQQAAQAAQELAVEKGKLSALQST
YDKCQADLQQLQSDLYGKESELLATRQDLKCVEEKLALAQEDLISNRNQIGNQNKSIQEL
QAAKAALEQDLAKKEEVLKEQSKALQDAQREKSVKEKELVTEKSKLAEMEEIKCRQEKEI
AKLKEELKSHKQESIKEVTNLKDAKQLLIQQKLELQGKVDSLKAALEQEKERQQLMREQM
RKEEEKRKEEFSEKEAKLHSEIKEKEAGVKKHEENEAKLTMQVTTLNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggaggatcttgcagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaatacggtggatgtcaataatgaaagttcttcagagggt
tttatatgtccccagtgtatgaaatctcttggctcagctgatgaacttttcaaacactat
caggcagttcatgatgccggtaatgactcggggcatggtggagaggccagtcttgctttg
acacgagatgacatagcactactcaggcaagaggtccaagacctgcaggcctcacttaag
gaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatatcaagggctacag
cagcaagaggctaaatctgatggattggtgactgattcatcagcagagctacagtcttta
gagcaacaattagaagaagcccaaactgagaattttaatattaagcaaatgaaagatctg
tttgaacagaaagcagctcaacttgctactgaaattgcagatataaagtcaaaatatgat
gaagaaaagggtctccgagcagctgcggaacaaaaagcgacacatttgacagaagaatta
agtaaacagacgactgtaattcaagacctgaaaactgagctgcttcagagacctggtata
gaagatgtcgctgtactaaagaaagaactggtccaagttcaaactctaatggataacatg
actttggagcgtgagagagaatctgaaaaactcaaggatgaatgtaaaaagttacagtca
gaacacgctaactcggaggctaccataaaccagctaaggagtgaacttgccaaaggcccc
caagaagttgcagtatatgtgcaggaaatacaaaaacttaaaggttcagttaatgaatta
acacaaaaaagccagaccttgatggagaaattgcagaagaaagacctggattacacccac
ttagaggagaagcataacgaagaggcactgagtagaaagaatacccaggcagccctccac
caaagggacctggattgccagcagcttcaggcaaggctaactgcatccgaaggctcgcta
cagaggatccaaggagagctcagggaaaagggagaggctgctcagaagctcaaagaagaa
ctgcgggaagtagagaccaagcaccagcatcttaaagtggagttcaagcagctgcagcag
cagcgggaagagaaggagcagcatgggctgcagctgcaaggggaagtcagtcagttacat
agcaaacttctggagactgagcgccaactaggggaagctcacggtaggctgaaggagcag
aggcaactttcaagtgagaagctgatggataaggaacagcaagtggctgacttacagctc
aagctctctcgtctggaagagcagttgaaggaaaaggtaacaaattccactgaattgcaa
catcaattagaaaaatcaaagcaacagcaccaagaacagcaagcccttcagcaaagcact
acagccaaactccgagaagctcagaatgatttagaacaagtgttacgtcagattggagat
aaggaccaaaagatccagaaccttgaagccttactacagaagagtaaagaaaatatttcc
ttactagaaaaggaaagagaagacctttatgcaaaaatccaagccggtgaaggagagact
gctgtccttaaccagttgcaagagaaaaaccatgcactacagcagcaactaactcaactg
atggagaagctgaagaatcagtcggaaagccataaacaagctgaggagaacttgcatgac
caggtacaggagcagaaggcacatcttcgagctgcacaagaccgtgttctttctctagaa
accagtgtcagtgaactaagcagtcagttaaatgaaagcaaggagaaggtttcccagctt
gacatacagattaaagccaaaactgaattattgctatcagcagaagcagcaaaaactgct
caaagagctgatcttcaaaatcatttggacacagctcaaaatgcactacaagataaacaa
caggagttaaataaggtcagtgcacagctggatcaggtcactgcaaagtttcaggagaag
caggagcattgcactcagctggaaagccatctcaaggattacaaggagaagcacctctct
ctagaacaaaaagcggaagacttagaaggccagattaagaaactagaagccaataatctt
gaagttaaagcaagcagggagcaagctgtgcagagcctacagcagcagaggcagctgagc
acagacctagagctcaggaatgcagagctcaggaagcagcttcaagagcagaaggaagta
gtatctcatacaaaattggatctacagaataaatctgaagcccttgaaaatattaaacaa
accctcactaagaaagaagaagaaaaagttgtcttgaaacaggaatttgaaaagttaagt
caagattcagaggcgcagcacaaggagctgagtgacaggatgcaagctgcgatcacagag
ctgatggtgatgacagcacagaaggacgctctcctggctgagctctccacaacaaaaggg
aaactgtcaaaagtttcagattctttacaaacctccaggagcgaatttgagaaagagagt
cagaaaggaaaggctgctgtactagacttggaaaaagcttgtaaagaattaaagcatcag
cttcaacaacaaacagaaagtgcactgaaggagcagagtgaactgaaaaagtcactggag
aaggagagagagacttctcaacagttgatgatagaactcaattcagtcaagggagaagtc
acacaggctcaaaatacattaaagcagaaggagaaagaagagcagcagcttcaggggaac
ataaatcagctgaagcaagcaactgagcaaaagaaaaagcaaatggaagctcttcaagga
gagcttaaaaacgttacttcacaaaaggcccagctggagagtaaactgcagcagcaggcg
gcacaggcagcccaggaacttgctgtggagaaaggaaagctgtcagcactgcagagcacc
tatgacaagtgccaggccgacctgcaacagctgcagtctgacctctatggcaaagagtct
gaacttctagccacaaggcaagaccttaagtgtgtagaagagaagcttgctctggcacaa
gaagacctgatttcaaacagaaatcaaattggaaaccaaaataaatcaattcaagaactg
caggctgccaaagctgctttggagcaggacttagcaaagaaggaggaggtgctcaaggag
cagagtaaagcactgcaggatgcgcagagagaaaagtcagtgaaggaaaaagaactagta
actgaaaagtctaaattggcagagatggaggaaattaaatgtagacaagaaaaagaaatc
gctaaactcaaagaagaactcaagtcccacaaacaagaaagcataaaggaagtaacaaat
ctcaaggatgccaaacaacttttgattcaacagaaattagaactccaaggcaaagtggac
tcactgaaggcagctcttgagcaggagaaggagcgtcagcagctaatgcgggagcagatg
aggaaggaagaagagaagcggaaggaagaattttctgagaaggaagcaaaactgcattct
gaaataaaagaaaaggaagcaggagtgaagaaacatgaagaaaatgaggctaagcttacc
atgcaggtcacaacattaaatgaaaacttgggcactgtgaagaaggagtggcagtctagt
caacggagagttagtgagcttgagaagcagacggatgacttacggggtgaaatcgctgtc
ttagaagcaactgttcagaataatcaggatgaaagaagagcactgctagagagatgtctt
aaaggagaaggtgaaatagaaaagcttcagaccaaagtcctagagttgcaaagaaagctg
gataacacaactgcagctgtgcaggagctgggcagagaaaaccagtccctacagatcaaa
cacacacaagccctgaacagaaagtgggcagaagacaacgaggtacagaactgcatgtcc
tgtgggaagtgcttctcagtcaccgtgcggcggcaccactgccgacagtgtggaaatatc
ttctgtgctgagtgttcagccaaaaacgccttaactccttcttcgaagaagcctgttcgt
gtctgtgatgcatgtttcaatgatttgcaaggataa

DBGET integrated database retrieval system