KEGG   Rattus norvegicus (rat): 314862Help
Entry
314862            CDS       T01003                                 

Gene name
Dyrk2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     314862 (Dyrk2)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   314862 (Dyrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q22
AA seq 527 aa AA seqDB search
MNDHLHISHSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLESIHRRQ
GSSTSLKSMEGMGKVKASPMTPEQAMKQYIQKLTAFEHHEIFSYPEIYFLGPNAKKRQGM
TGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVR
NEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKK
NKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCY
EHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACM
IELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESR
EWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKRVT
ESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccacctccacatcagccacagccacggacagatccaggttcagcagctgttc
gaggacaacagtaacaaaaggacagtgctcacaacccaacccaatgggcttacgacggtg
ggcaagacgggcttgcctgtggtgcctgagcggcagctggagagcattcacagacggcag
gggagttccacctctctgaagtccatggaaggcatggggaaggtaaaagccagccccatg
acacctgaacaagcgatgaagcaatacattcaaaaactcacagccttcgaacaccacgag
attttcagctaccccgaaatctacttcttgggtccaaatgcaaagaagcgccaaggcatg
acaggtggacccaacaatggcggttatgatgacgaccagggatcatacgtgcaggtgccc
cacgatcacgtggcttacaggtacgaggtcctcaaagtcatcgggaaggggagctttggg
caggtggtcaaggcctatgaccacaaagtccaccagcacgtggccctgaagatggtgcgg
aacgagaagcgcttccaccggcaggcggcagaggagatccggatcttggaacacctacgg
aagcaggacaaggacaacaccatgaacgtcattcacatgctggagaacttcaccttccgc
aaccatatctgcatgacgttcgagctgctgagcatgaacctctatgagctcatcaagaag
aataagttccaaggcttcagcctgcctctggtgcgcaagttcgcccactccattctgcag
tgcttggatgctttgcacaaaaacagaataatccactgtgaccttaagcccgagaacatt
ttgttaaagcagcagggtcggagcagtattaaagtgattgactttggctccagttgttat
gagcaccagcgcgtctacacgtacatccagtcgcgcttttaccgggctccggaagtgatc
cttggagccaggtatggcatgcccattgacatgtggagcctgggttgcatcctcgcggaa
cttctgacgggttaccccctcttgcctggggaggatgaaggggaccagctagcttgtatg
atcgagcttttgggcatgccctctcaaaaactcctggatgcttccaaacgagccaaaaat
ttcgtgagctctaagggttacccccgatactgcactgttacaactctttcggatggctct
gtggtactcaacggaggcagatcccggagagggaaactgaggggtccgccagagagcaga
gagtgggggaatgcactgaagggatgtgatgatcctcttttccttgacttcttaaaacag
tgtttggagtgggatcccgcggtccgaatgaccccgggacaggctctacggcacccgtgg
cttaggaggcgtttgccaaagcctccgaccggggagaagactgcggtgaagagggtcaca
gagagtactggtgctatcacctccatttccaagttacctccaccttccagctcagcttcc
aagctgaggactaatttggcacagatgacagatgccaatgggaatattcagcagaggaca
gtgttgccgaaactcgttagctga

DBGET integrated database retrieval system