KEGG   Rattus norvegicus (rat): 315219Help
Entry
315219            CDS       T01003                                 

Gene name
Tymp, Ecgf1
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    315219 (Tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    315219 (Tymp)
 Human Diseases
  Cancers
   05219 Bladder cancer
    315219 (Tymp)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     315219 (Tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 476 aa AA seqDB search
MAAPGTPPPLAPETAGADSGGGSGEHRQLPELIRLKRNGGHLSEADIRNFVHALMDGRAQ
DTQIGAMLMAIRLQGMDLEETSVLTQALAESGQQLEWPKAWHQQLVDKHSTGGVGDKVSL
VLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFSVTQSPEQMLQILEEVGCCIVGQ
SEKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLSTLVVDVKFGGAAVFPDQEK
ARELAKMLVRVGMGLGLQVAAALTAMDNPLGRNVGHTLEVEEALLCLDGAGPPDLRDLVI
RLGGAILWLSGQAETQDQGAARVAAALDDGSALHRFQLMLSAQGVDPGLARALCSGSPTQ
RRQLLPHARKQEELLSPADGIVECVRALPLACVLHELGAGRSRAGQPIRPGVGAELLVDV
GQWLSRGTPWLRVHLDGPALSSQQRRTLLGALVLSDRAPFKAPSPFAELVLPPTTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagggacaccacctcccttggccccagagacagctggtgccgactcgggg
ggagggagtggggagcacaggcagctgccagagctgatccgcctcaagcgaaatggaggg
catctgagcgaagcagatatcagaaacttcgtgcacgcgttgatggacggaagagcacag
gacacacaaatcggggccatgctgatggccattcggctgcaaggcatggacctagaggag
acatctgtgttgactcaggccctcgcagagtctgggcagcaactggagtggcccaaggcc
tggcaccagcagcttgtggacaaacactccacaggaggtgtgggcgataaggttagcctg
gttctggcacctgccctggctgcatgtggctgcaaggtaccaatgatcagcggacgcagt
ttgggacacacagggggcacgctggataaactggaatctattcctgggttcagcgtcacc
cagagcccagaacagatgctgcagatacttgaggaagtcggctgctgcattgttggccag
agtgaaaagctagttcctgctgatggaatcctgtatgctgcacgagatgtgacagctact
gtggacagtgtaccgctcattacagcgtcaatcctcagtaagaaagccgtggagggactg
tccactctggtggtagatgttaagtttgggggggctgcagtcttcccagaccaggagaag
gcccgagaactggcaaagatgttggttagagtgggaatgggtctggggctgcaggttgct
gcagccctgaccgccatggacaaccctctgggccgcaacgtgggtcataccctggaagtg
gaagaagcgttgctttgcctggatggtgcggggccgccggatctgcgggacctggtcatt
aggctaggaggcgccattctttggcttagcggacaggcagaaacccaagaccagggtgcc
gcccgagtggccgcggcgttggatgatggctctgcgctgcaccgcttccagctgatgctt
tcggcgcagggcgtagaccccggcctagctagagcattgtgctccggaagccccacgcaa
cgccggcagttgctgcctcacgcccgaaagcaagaagagctgctctcaccggcagacggc
attgtggagtgcgtccgagcgctgccgctggcctgtgtactgcacgagctcggagccgga
cgcagccgagcagggcagccgatcagaccgggagtgggtgccgaactactggtcgacgtg
ggccaatggttgtcccgcgggacaccctggctccgcgtgcacctggacggccccgcgctc
agcagtcagcagcgccgcactcttctgggggctctcgtgctgtcagatcgagcacccttc
aaggccccttcacccttcgctgagcttgtcctcccaccgaccaccccatag

DBGET integrated database retrieval system