KEGG   Rattus norvegicus (rat): 315344Help
Entry
315344            CDS       T01003                                 

Gene name
Smug1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    315344 (Smug1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     315344 (Smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q36
AA seq 278 aa AA seqDB search
MAVSQTFPPGPAHEPASALMEPCARSLAEGFLEEELRLNAELSQLQFPEPVGVIYNPVDY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGIGGSVLSPPQE
HPKRPVLGLECPQSEVSGARFWGFFRTLCGQPQVFFRHCFVHNLCPLLFLAPSGRNLTPA
DLPAKHREQLLSICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLTPEVQVEGLLHP
SPRSPQANKGWETAARERLQELGLLPLLTDEGSVRPTP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcccagactttcccaccggggcctgcccatgagcctgccagtgccctgatg
gagccttgcgctcgaagcttagctgagggcttcctggaggaagagcttcggctcaatgct
gagctgagccagctgcagtttccagagcctgtgggtgtcatctacaacccagtggattat
gcttgggagccacaccggaactacgtgactcgctactgccaaggccccaaggaagtgctg
ttcctgggcatgaatccaggaccttttggcatggcccaaactggggtaccttttggggaa
gtgaatgtggtccgggactggttgggcattgggggctctgtgctgtcccctccccaagag
caccctaagcgaccagtgttgggactggagtgcccgcagtcagaggtgagcggagcccga
ttctggggcttttttcggaccctctgcggacagcctcaagtcttcttccggcactgcttt
gtccacaatctgtgtcctctactcttcttggctcccagcgggcgaaaccttaccccggct
gatctgcccgccaagcaccgggagcagctactgtcgatctgcgacgccgccctctgccgg
caggtgcagctgctaggggtgcggctggtagtgggagtggggcggctggcagagcagaga
gctcgaagagctctagcagggctgaccccggaggtgcaggtggaggggctcctgcatcca
tctcctcgaagcccgcaggccaacaaaggctgggaaacagcagccagggaaagactccaa
gagttggggctgctgcctctgctaacggatgagggttcagtcaggcctacaccatag

DBGET integrated database retrieval system