KEGG   Rattus norvegicus (rat): 315639Help
Entry
315639            CDS       T01003                                 

Gene name
Usp28
Definition
ubiquitin specific peptidase 28 (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q23
AA seq 1079 aa AA seqDB search
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
QRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDS
RDLNRIHEANSAETKRSKRKRCEVWGENHNPNNWRRVDGWPVGLKNVGNTCWFSAVIQLP
EFRRLVLSYSLPQNILENCRSHTEKRNIMFMQELQYLFALLLGSNRKFVDPSAALDLLKG
AFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSNPRTKSENPMVQLFYGTFLTEGVRE
GKPFCNNETFGQYPLQVNGYHNLDECLEGAMVEGDIALLPSDRSVKYGQERWFTKLPPVL
TFELSRFEFNQSLGQPEKIHNKLEFPQVIYMDRYMYKSKELIRSKRESIRKLKEEIQVLQ
QKLERYVKYGSGPSRFPLPDMLKYVIEFASTKPASESCLSGSVEHMTLPLPSVHCPISDL
TAKESSSPKSCSQNAEGSFSSPEDALPNSEVMNGPFTSPHSSLEMPAPPPAPRTVTDEEM
NFVKTCLQRWRSEIEQDIQDLKNCISSTTQAIEQMYCDPLLRQVPYRLHAVLVHEGQASA
GHYWAYIYNQPRQIWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHCSAE
AAHGESDQTAEVEALSVELRQYIQEDNWRFEQEVEEWEEEQSCKIPQMESSPNSSSQDFS
TSQESSAASSHGVRCLSSEHAVIAKEQTAQAIANTAHAYEKSGVEAALSEVMLSPAMQGV
LLAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAP
KRVVERTLLEQFADRNLSYDERSISIMKVAQAKLMEIGPEDMNMEEYKRWHEDYSLFRKV
SVYLLTGLELFQKGKYQEALSYLVYAYQSNAGLLVKGPRRGVKESVIALYRRKCLLELNA
KAASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGKDI
AENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggagctgcagcaggacgacgcggcgggggcggcggacggccatggctcgagc
tgccagatgctgttaaatcagctgcgagaaatcacgggcatccaggatccttcctttctt
catgaagcattaaaggccagtaatggtgacatcacccaggctgtcagccttctcacagac
caaagagttaaggagcccagtcacgacacagctgctacagaaccatctgaagtagaagag
agtgctaccagcaaagatctcttagcaaaagtgatagaccttacacatgacaacaaagat
gaccttcaggcagccattgccttgagtctcctggagtctcctaacattcagactgacagc
agagatcttaatagaatacatgaagctaactctgcagagactaaacgatcaaagagaaaa
cgctgtgaagtttggggagaaaaccacaatcccaataactggaggagagtggatggttgg
ccagttgggctgaaaaatgttggcaacacatgttggttcagtgctgttattcagttgcct
gaatttcgaagacttgttctcagttacagcctgccacagaacattcttgaaaattgtcga
agtcacactgaaaaaagaaatatcatgtttatgcaagagcttcagtatttatttgctctg
ttattgggatcaaatcggaaatttgtagatccttctgctgccctggatctactgaagggg
gccttccgatcctcagaggagcaacagcaagatgtgagtgaattcacacacaagctcctg
gattggctggaggatgcgttccagctagctgttaatgttaacagcaatcccaggactaaa
tctgaaaaccccatggtgcagctgttctacggtaccttcctgacagaaggggtccgagaa
ggaaaacccttttgtaacaacgagaccttcggccagtaccctcttcaggtaaacggttac
cacaacttagacgagtgtttggaaggggccatggtggaaggtgacattgcgctgcttcct
tctgatcgctcagtgaaatacggacaagagcgttggtttacaaagctgcctccagtgttg
accttcgaactctccagatttgagtttaatcagtctcttgggcagcctgagaaaattcat
aataagctggaatttcctcaggttatttatatggataggtacatgtacaaaagcaaagag
cttatccgaagtaagagagagagcattcgaaagttgaaggaggaaatacaagttctgcag
cagaaattagaaaggtatgtgaagtacggctccggtccatctcgcttcccactccccgac
atgttgaaatacgttattgaatttgccagtacaaaacctgcctctgaaagctgtctgtct
ggaagtgttgagcatatgacgttaccacttccttctgtgcactgcccgatttctgacctc
acagccaaggaaagttcaagtcccaaaagctgctctcagaatgctgagggttccttttcc
tctccggaagatgctctacccaactctgaggtaatgaatgggccatttacttctcctcac
tcttccctggaaatgcctgcacccccaccagctcctcggacagtcacagatgaggaaatg
aatttcgttaagacctgtcttcagaggtggcggagtgaaattgaacaggatatacaagac
ttaaagaattgtatctcgagcaccacccaggctattgagcagatgtactgtgatcctctt
cttcgtcaggtgccttatcgcttacatgcagttcttgttcatgaaggacaagccagtgca
gggcactactgggcgtacatctataaccagccccggcagatctggctcaaatacaacgac
atctctgtcactgagtcttcctgggaagaacttgaaagagattcttacgggggcctgaga
aatgtcagcgcatactgcttgatgtatatcaatgacaagttgccccactgcagtgcagag
gcagcgcatggtgaatctgatcagactgcagaagtggaagccctgtctgtggaactcagg
cagtacattcaggaagataactggaggtttgagcaagaggtggaggaatgggaggaagaa
cagtcctgtaagatcccacagatggagtcctccccaaactcttcctcacaggatttttcc
acatcacaagagtcttcagcagcgtcctcgcatggcgttcgatgtttgtcttctgaacat
gctgtgattgcaaaggagcagactgcccaggccatcgcaaacacggctcatgcctatgag
aagagcggggtagaagcagccttgagtgaggtgatgctgagccctgccatgcaaggggtc
ctcctggccatagctaaggcgcgccagacctttgaccgagacgggtctgaagcagggctt
attaaggcatttcatgaagagtactccaggctctatcagcttgccaaagagacacccacc
tctcacagtgatcctcgccttcagcatgttctcgtctactttttccaaaatgaagcaccc
aagagggtagtagaacgaacccttctggaacagtttgcagatagaaaccttagctatgat
gagagatctatcagtatcatgaaggtggctcaggccaaactgatggaaattggtccagag
gacatgaacatggaagagtataagaggtggcatgaagactatagtctgttccgaaaggtg
tctgtgtacctgctaacgggcctggaactcttccaaaaaggaaagtaccaggaagctttg
tcctacctggtgtacgcgtaccagagcaatgctggcctgctggtgaaggggccccgcagg
ggcgtgaaggagtctgtgattgctttgtaccgcagaaaatgccttctggagttgaatgcc
aaggctgcttctctttttgaaacaaatgacgaccattctgtaacagagggcattaatgtg
atgaatgagctgatcattccctgcatccacctgatcattaataatgacatttccaaggac
gaccttgatgccatcgaggtcatgaggaaccactggtgctcttacctggggaaggacatc
gcagaaaatctgcagctgtgtttaggggagttcctacccaggcttctagatccttccgca
gaaatcatcgtcctaaaggagcctccaactattcgaccgaattctccctatgatctttgc
agccggtttgcagctgtcatggagtccattcaaggagtttcaacagtaacagtgaagtaa

DBGET integrated database retrieval system