KEGG   Rattus norvegicus (rat): 315852Help
Entry
315852            CDS       T01003                                 

Gene name
Ttk
Definition
Ttk protein kinase (EC:2.7.12.1)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    315852 (Ttk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     315852 (Ttk)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  TTK family
   315852 (Ttk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q31
AA seq 835 aa AA seqDB search
MEAEELIGRNLTIDSIMNKVRDIKNKINEDLTDELNSIKVCVDPTETVNQIMMVENTPEN
WLNFLLKLEKNSPPLNDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRLAELKAIQE
PDDAHDYFQMARENCKKFAFVHVSFAQFELSQGNLKKSEQLLHKAVETGAVPLQMLETAI
RNLHLQKKQLLSEEDKKSLSASTVLTAQESFSSSLGNLQSRKSSCDPKVQAAAARILYGE
NMPPKDAEVSHRNPLKQTNKTKRSCPFGRVPVNLLNSPDYYVKTDGSAVPQFTKRKISGS
EYRDSIMPGSKSSGNDSYELRGLKPIQAIHLKDSLVSNEKSSELMSDLVTLKSKTDSSLT
KLEEPKVRQEPEIPERRHKQWQSARKPGCGIQNSAAFAPQWHVPDVTPKADKESPPLSVP
KWIDPKSVCETPSSSSLDDYMKCFKTSVVKNEFPPACPSSTPYSQLARHQQHQQQGLSTP
LQNLQISGSSSMSECISVNGRIYSILKQIGSGGSSKVFQVLNEKKQINAIKYVNLEDADS
QTIDSYRNEIAYLNKLQQHSDKIIRLYDYEITDRYIYMVMECGNIDLNSWLKKKKSINPW
ERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSIVKDS
QVGTVNYMAPEAIRDMSSSRENGKIKTKISPRSDVWSLGCILYYMTYGKTPFQHIINQVS
KLHAIIDPSHEIEFPEISEKDLRDVLKCCLVRNPKERISIPELLAHPYVQIQPHPGSQMA
KETTDEMKYMLGQLVCLNSPNSILKAAKTLYERYNCGESQAPSSSKTSDKKRERE
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgaagagttaattggcagaaatttgacaattgattccatcatgaacaaagtg
agagacattaaaaataagataaatgaagaccttactgatgagctaaactcgatcaaagtc
tgtgttgaccccacagaaactgttaaccaaattatgatggttgagaacacaccagagaac
tggttgaatttcttgctgaaactagagaaaaacagcccacctctaaacgatgctctttta
aataagctgattggtcggtatagtcaagccattgaagcacttcctccagataaatatggc
cagaatgagagctttgctcgaatacaagtgagacttgcagaattaaaggctattcaagaa
cctgacgatgctcacgactacttccaaatggcccgagagaactgcaagaagtttgctttc
gtgcatgtctctttcgcacagtttgaactgtctcaaggcaatcttaagaaaagcgaacag
cttcttcataaagctgtagagacgggggcagtgccgctgcagatgctggagactgccatc
cgtaacctacacctccagaaaaagcagctgctctcagaggaggacaaaaagagtttatca
gcatctacagtactaactgcccaagaatcattctccagttcacttgggaatttacagagt
aggaagagcagctgcgatcccaaagtacaggctgctgcagccaggattttatatggggag
aacatgcctccaaaagatgcggaagtaagtcatcgaaatcccttaaagcaaactaacaaa
actaaacggtcatgcccctttggaagagtcccagttaatcttctaaatagcccagattac
tatgtgaagacagatggttcagctgtgccacagtttacaaaaagaaaaatatctggatca
gaataccgagattcgattatgcctggatccaaatcaagtggaaatgattcctatgaattg
agaggtttaaagcccattcaagctatccatttgaaagactctctggtgtccaatgaaaaa
agttctgaacttatgtctgatttagtaaccttgaagagtaaaacggattcaagtctaaca
aagttggaagaacctaaagtgcgtcaagaaccggagattccagaaagaaggcacaagcag
tggcagtctgccagaaagccaggctgtgggatccagaactcggctgcctttgccccccag
tggcacgttccagatgtaaccccaaaggctgataaagagtcaccaccattatcagttcct
aaatggattgatccaaagtctgtctgtgagacacctagtagcagttccttggatgattac
atgaaatgttttaagacttcagttgtaaagaatgaattcccacctgcctgtccatcatca
acaccttacagccaacttgcccgccaccagcagcatcagcagcaagggctcagcactcct
cttcaaaacttacagatttcaggatcctcatcaatgagtgaatgcatttcagttaacgga
agaatttattccatattaaaacagataggcagtggaggttcaagtaaggtgtttcaggta
ttgaatgagaagaaacagataaacgctatcaaatacgtgaaccttgaagacgcagatagc
caaactattgacagctaccgcaatgagatagcttacttgaacaagttacagcagcacagt
gataagatcatccgcctctatgactatgaaatcacggatcggtacatctacatggtgatg
gaatgtggaaacattgacctgaacagttggcttaaaaagaagaaatccatcaatccatgg
gaacgcaagagctactggaaaaacatgttggaggccgtacacacgatccatcaacatggc
attgttcatagtgatctcaagcctgctaactttctaatagttgacggaatgctaaagcta
attgattttgggattgcaaaccaaatgcagccagatacaacaagcattgttaaagattct
caggttggcacagtaaactacatggccccagaagcaatcagagacatgtcttcttcaaga
gaaaatgggaaaatcaagaccaagataagtcccagaagtgatgtgtggtccttggggtgc
attttgtactatatgacctacgggaaaacaccatttcagcatatcattaatcaggtctct
aaactacatgccataattgaccctagtcatgaaattgagtttcctgagatttcagaaaaa
gatcttcgagatgtgctaaagtgctgcctagtacggaaccctaaagagaggatatctatc
cccgagctcctcgcacatccatatgttcagattcagccccatccaggcagccaaatggct
aaggagaccactgatgagatgaaatatatgttgggtcaacttgtttgcctgaattctcct
aactccatcctgaaagctgcgaaaaccttgtatgaacgttataattgtggtgaaagtcaa
gctccttcatcatccaagacttctgacaaaaagagagaaagagagtga

DBGET integrated database retrieval system