KEGG   Rattus norvegicus (rat): 315903Help
Entry
315903            CDS       T01003                                 

Gene name
U2surp, RGD1307882
Definition
U2 snRNP-associated SURP domain containing
Orthology
K12842  
U2-associated protein SR140
Organism
rno  Rattus norvegicus (rat)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:rno03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8q31
AA seq 1029 aa AA seqDB search
MADKTPGGSQKASSKSRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESG
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDVPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDAAEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPVREEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKK
DKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERS
HKESSRSRSSHKDSPRDASKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRS
HKKSKKNKH
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaaacgccaggcggatctcagaaggccagttcaaagagccgatcatcggat
gttcattcatctggatcttcagatgctcatatggacgcatctggaccctcagatagcgat
atgccaagtcgaacacgacctaaaagcccaagaaaacacaattataggaatgaaagtggc
cgtgaaagcctttgcgattctcctcatcagaatctctcaagacctcttctagaaaacaag
cttaaagcattcagtattggaaaaatgagcacagcaaagcgaactctaagtaagaaggaa
caagaggaactgaagaaaaaggaggatgaaaaggcagctgctgaaatttatgaggaattt
cttgctgcttttgaaggaagtgatggtaataaggtgaaaacgtttgttcgaggcggggtt
gttaatgcagctaaagatgaacatgaaacagatgaaaaaagaggtaaaatctataagcca
tcttcaaggtttgcagatcaaaagaatcctccaaatcagtcatccaatgaaaggccacca
tctcttcttgtgatagagacgaaaaagcctccactgaagaaaggggagaaggaaaagaaa
aaaagcaatttggaacttttcaaagaagaactaaaacaaattcaggaagaacgtgatgag
agacataaaacaaaaggcaggttaagtcggtttgagcctcctcagtcagactctgatggt
cagcgacgttccatggatgtgccttcaagaagaaatagatcgtctggtgttcttgatgat
tatgcaccgggctcacatgatgtaggagatcccagcactacaaacttatacctcggaaac
attaatccacagatgaatgaagaaatgctgtgccaagaatttggaagatttggaccatta
gctagtgtaaaaattatgtggcctagaactgatgaagaaagagcacgagaaagaaattgt
ggctttgtggcttttatgaatagaagagatgctgagagagctctaaaaaatttaaatgga
aaaatgattatgtcttttgaaatgaagttaggttggggtaaagctgtacctattcctcca
cacccaatatacattccgccttctatgatggaacacacacttcccccacctccatccgga
ctgccttttaatgcgcagcctagagagcgattaaaaaaccccaatgctcccatgttacca
ccacctaaaaacaaggaggattttgagaagactctgtcgcaagccatagtcaaagtggtt
atcccaacagaaaggaatttactcgccctgatacaccgaatgatagaatttgttgtacgt
gaagggccaatgtttgaagctatgattatgaacagagaaatcaacaatcctatgttcagg
ttcttatttgaaaaccagacaccagcccacgtttactacaggtggaagctttattctatt
ctgcagggagattctccgacaaaatggcggacagaagattttcggatgttcaaaaatgga
tccttttggaggccaccaccattaaatccataccttcatgggatgtcagaggagcaggag
acagaagcgtttgtagaagagcctagtaaaaagggagcactcaaggaagaacagcgggat
aaattagaagaaatcttgcgaggattaactccaaggaaaaatgatattggagatgccatg
gttttctgtcttaataatgctgaagctgctgaagaaatagtggactgcattactgagtca
ctgtctatcttaaagaccccgcttcccaagaagattgccagattatatttggtttctgat
gttttatataactcttcagccaaagttgccaatgcttcatattataggaaattttttgaa
acaaagctatgtcagatattttcagacctcaatgctacttatcgtacaattcaaggccat
ttacaatctgaaaattttaagcaacgggtaatgacctgcttcagagcatgggaagattgg
gcaatttatccagaaccatttttgatcaaacttcagaatattttcttaggacttgtaaat
atcattgaagaaaaggaaacagaggatgtgccagatgatcttgacggtgctcccattgag
gaagagcttgatggtgctcctctggaagatgtggatggaattcccattgatgctactccc
atcgatgatcttgatggcgtccctataaaaagtctcgatgatgatctggatggagtgcct
ttggatgcagctgaagactcaaagaagaatgaacccatatttaaagttgccccatcaaag
tgggaggctgtagatgaatctgagttggaagcacaagcggtgacaacttccaagtgggag
ttatttgaccagcatgaagaatcagaagaagaagaaaaccaaaatcaggaagaagagagt
gaagatgaagaagacacccagagttccaagtcggaagagcatcatttatattctaaccca
gtcagagaagagatgactgagtctaagttctctaagtactccgaaatgagtgaggagaaa
cgagctaagctccgtgaaattgagctaaaagttatgaagtttcaagatgaattggaatct
ggaaagagaccaaaaaaacccggccaaagcttccaggagcaagtagaacactacagagat
aaactgctgcagcgagagaaggagaaagaattagaaagagaacgagaaagagacaaaaaa
gataaagaaaaattggaatctcgatccaaagacaagaaggaaaaggatgaatgtactcca
acgagaaaagagaggaagagacgacatagcacctcccccagcccatctcgaagtagcagt
ggtcgacgagtgaaatccccatcacccaaatcagagcggtccgaacggtcagaaaggtct
cataaagaaagctctcggtccaggtcctctcacaaagactcccctagagatgctagcaaa
aaagccaaaaggtcaccgtctggttcaaggacacctaaaaggtctaggcggtcccggtct
aggtccccgaagaagtcagggaagaaatccagatctcagtcccggtctccacacaggtct
cataaaaagtcaaagaaaaacaaacactga

DBGET integrated database retrieval system