KEGG   Rattus norvegicus (rat): 316033Help
Entry
316033            CDS       T01003                                 

Gene name
Glb1
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    316033 (Glb1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    316033 (Glb1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    316033 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    316033 (Glb1)
   00511 Other glycan degradation
    316033 (Glb1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    316033 (Glb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     316033 (Glb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   316033 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q32
AA seq 647 aa AA seqDB search
MFRVPLCMLLPLLALLQLLGAAHSFYNVSQRTFELDYKRDRFLKDGQPFRYISGSIHYFR
IPRFYWEDRLLKMKMAGLDAIQTYVPWNFHEPQPGQYDFSGDRDVEHFIQLAHQLGLLVI
LRPGPYICAEWDMGGLPAWLLEKESIVLRSSDPDYLAAVDKWLAVLLPKMKRLLYQNGGP
IITVQVENEYGSYFACDYNYLRFLEHRFRYHLGNDIILFTTDGAAEKLLKCGTLQDLYAT
VDFGTTGNITRAFLIQRNFEPKGPLINSEFYTGWLDHWGQPHSKVNTKKLVASLYNLLAY
GASVNLYMFIGGTNFAYWNGANMPYAPQPTSYDYDAPLSEAGDLTEKYFAVRDVIRKFKE
VPEGPIPPSTPKFAYGKVALRKFKTVTEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPINGVRDRAYVSVDGVPQGILDRNRMNVLNIRGKAGATLDILVE
NMGRVNYGNSIKDFKGLISNMTLNFTVLTNWTMFPLDTEALARSHLGNWEAADEGHLDGH
STLRSSNFTLPTFYVGNFSIPSGIPDLPQDTFIQFPGWAKGQVWINGFNLGRYWPTKGPQ
MTLFVPRNILTTSAPNNITVLELESSPCSNGTLELCTVEFVDTPVIG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgttccgggtccccctgtgtatgctgctcccgctcctggcgctcctgcagttgctgggc
gctgcgcacagtttctataatgtctcccagaggacatttgagctggactacaaacgggac
cgcttcctcaaggatgggcagccattccgctacatctcgggaagcattcactacttccgg
ataccccgattctactgggaggaccggctgctaaagatgaagatggctgggctggatgca
atccagacgtacgtgccctggaacttccatgaaccccagccaggacaatatgacttttct
ggggaccgtgatgtggaacatttcattcagctggctcaccagctgggactcctggtgatc
ctgaggcctgggccctacatctgtgcagagtgggacatggggggcttacccgcttggtta
ctagagaaagaatcgatcgttctccggtcttccgacccagattaccttgcagctgtggat
aaatggctggcagtccttctgcccaagatgaagcgtctgctctaccagaacggagggccc
atcataaccgtgcaggttgagaatgagtacgggtcctacttcgcctgcgattataactac
ctgcgtttcctggagcaccgcttccgctaccatttgggtaacgacatcattctcttcacc
actgacggagcagctgaaaaattactcaagtgtgggaccctgcaggacctctacgccaca
gtggattttggaacaaccggcaatatcacacgagctttcctgatccagaggaattttgaa
cccaaaggacctttgatcaattctgagttctatactggctggttagaccactggggtcaa
ccccattccaaagtgaatactaagaagttggtggcctccctctataacctgcttgcctac
ggggccagcgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggt
gccaacatgccctatgccccacagccaaccagctatgactatgacgccccactgagcgag
gcaggagacctcactgagaagtacttcgcagtacgagatgtcattcggaagtttaaagaa
gtcccagaaggccctatccctccatctacacccaagttcgcatatggaaaagttgctctg
agaaagttcaagacggtgacggaagctctgggtatactgtgtcccaacgggcccgtgaaa
agcctctaccccttgacgttcactcaggtaaaacagtattttgggtatgtgctataccga
acgacacttcctcaagattgcagtaacccgaaacccattttctcttcacccataaatggt
gtccgtgatcgggcctacgtctctgtggacggggtcccccaaggaatccttgatcgaaac
cgtatgaacgttctgaacattcgggggaaggccggagccacgctagacattctggtggag
aacatggggcgtgtgaactatggcaactccatcaaagactttaagggtttgatttccaac
atgaccctcaacttcactgtcctcaccaactggacaatgttcccactggacactgaggcc
ctggcacgcagccatcttgggaactgggaggccgctgatgagggtcacctcgatggacac
tcgaccttacgttcttcaaatttcacactccccaccttttacgtgggcaacttctccatc
ccctcgggcatcccagacctgccgcaggacaccttcatccagtttcccggatgggccaag
ggccaagtatggatcaatggctttaacctcgggcgatactggcccacaaagggcccacaa
atgaccttgtttgtgccaaggaacatcctgaccacttcagccccaaacaacatcacagtg
ctagaactggagtcgtcaccctgcagtaatgggaccctagagctatgtacagtagagttt
gttgacactccggttattggctga

DBGET integrated database retrieval system