KEGG   Rattus norvegicus (rat): 316211Help
Entry
316211            CDS       T01003                                 

Gene name
Usp49, RGD1310513
Definition
ubiquitin specific peptidase 49 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q12
AA seq 685 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESAWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDLPARRGRTLRST
AAGEDVVPPQRTPQGQPQMLTALWYRRQRLLAKTLRLWFEKSSRGRAQLEQRRQEEALER
KKEAARQRRREVKRRLLEELASAPPRKSARLLLHAPGPVAVRPATLATSRRMSAAALKPR
RQLAVAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSTSEHLFPQATNGKAQI
PSRPASSTAAGFSVRSDRAQGFEPQGFCWSSGASISRSLELIQNKEPSSKHISLCHELHT
LFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGSTRR
ILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCVSCNYKSNTIEPFWDLSLEFPERYHCVE
KGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIY
RLPQVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCGDMLSSLDKDTFAYDLSAV
VMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRRTVQGSA
KLSEPHLRAQVHSSSKDDRRTYTFP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttacggctcgcccaggatcactccatcctgaac
ccccagaagtggtgctgtctggagtgcgccaccaccgagtctgcgtgggcttgcctcaag
tgctcccacgtggcttgcggccgctacattgaagaccatgcactaaaacactttgaagag
accggacacccgctggccatggaggtccgggatctctacgtgttctgctacctgtgcaag
gattacgtgctcaatgacaaccccgaaggggacctgaagttgctaagaagctccctcctg
gctgttcgaggccagaagcaggacctgcccgcgaggcgtgggcggacgctgcggtccaca
gctgcaggcgaggacgtggtcccgccgcagcgtactcctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgcttgctggccaagacgctgcggctctggtttgag
aagagctcccgcggccgtgcgcagctggagcagcggcggcaggaggaggcgctggagcgt
aagaaggaggcggcgcggcagcgacggcgcgaggtcaagaggcggctgctggaggagctg
gccagcgcgccgccgcggaagagtgcgcgcctgctcctgcacgctcccgggcccgtggcc
gtgcgccctgctaccctcgctacctcccggcgcatgtccgctgctgccctcaagccgcgc
cgtcagctggcggtggccccgggtgttactgggctgcgcaacctgggtaacacctgctac
atgaactccatcctccaggtgctcagccacctccagaagttccgggaatgtttcctgaac
ctcgacccctccacctccgagcacctgtttccccaagcaaccaacgggaaggctcagatc
cctagcaggccagccagcagcactgccgcggggttctcagtaaggagtgaccgggcccag
gggttcgaacctcagggcttctgctggagcagcggagcctccatcagcaggagcctagag
ctcattcagaacaaggaacccagctcaaagcacatttctctctgccacgaactgcacacc
ctcttccgagtcatgtggtctgggaagtgggcgctggtatcaccctttgccatgcttcac
tccgtgtggagcctgattcccgccttccgaggctacgatcagcaggatgcgcaggaattt
ctctgcgaactgctgcacaaggtacagcaggagcttgagtctgagggctccacacgccgg
atcctcatccccttctcccagaggaagctcaccaagcaggtcttaaaggtggtgaacact
atatttcatgggcagctgctcagtcaggtcacatgtgtatcatgcaattataaatccaat
accattgagcccttttgggatctatccctggaatttcctgaacgataccactgcgtagag
aaggggtttgtccctttgaatcagacagagtgcctgctcactgaaatgctagccaagttc
accgagacagaggccctggaggggagaatctacgcttgtgaccagtgtaacagcaaacga
cgaaagtccaaccccaaaccccttgttctgagtgaagctaggaagcagttaatgatctac
agactacctcaggtcctccggctacaccttaaaagattcaggtggtctggccgtaaccat
cgtgagaagatcggggtccatgtcgtctttgatcaggtgttaaccatggaaccttactgc
tgcggggacatgctctcctcccttgacaaagacacctttgcctatgacctctccgcagtg
gtcatgcatcacgggaaagggtttggctcaggacactacacagcctattgctacaacaca
gagggaggtttttgggtccactgcaatgactcaaagctggatgtatgcagtgtggaggaa
gtgtgcaaaacccaggcctacattcttttttacactcgaagaacagttcagggcagcgca
aaactctcagaaccccatctccgagctcaggtgcactccagcagcaaggacgatcgcaga
acatacacatttccctga

DBGET integrated database retrieval system