KEGG   Rattus norvegicus (rat): 316421Help
Entry
316421            CDS       T01003                                 

Gene name
Aox2, Aox2p, Aox3l1
Definition
aldehyde oxidase 2
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:rno00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rno00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rno00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:rno00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rno00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:rno00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q31
AA seq 1345 aa AA seqDB search
MPCPSQSSDELEFFVNGKKVTEKNVDPEVTLLAFLRKNLRLTGTKYACGTGSCGACTVMV
SQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRLHPVQERLAKSHGTQCGF
CSPGMVMSMYALLRNHPQPSEEQLLEALGGNLCRCTGYRPILESGRTFCMESDGCLQKGT
GQCCLDQKEGDSSGSKSDICTELFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYG
ERITWIAPGTLQELLVLKAKYPEAPLISGNTALGPAMKSQGHFYPVLLSPARIPDLRMVT
KTSGGLTIGACCSLAQVKDVLAESISELPEEKTQTYRALLKHLRSLAGQQIRNMASLGGH
VISRHYYSDLNPILSVGNATLNLLSEEGLRQIPLNGHFLAGLANEDLKPEEILGSVYIPH
SQKREFVSAFRQAQCHQNALPDVNAGMRVLFKEGTDIIEELSIAYGGVGPTTVSAHRSCQ
QLLGRRWNALLLDEACRLLLDEVSLPGSAVGGKVEFRRTLIVSFFFKFYLEVLQELKADK
RLLPESTDSQRYPEIADGSRSSLGDFQVTLPQGVQTYQRVNSHQPLQDPVGRPIMHLSGL
KHATGEAVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGN
NGEEDDKLLAVDKVLCVGQVVCAVVAETDVQAKRATKKIKITYEDLKPVLFTIEDAIQHN
SFLCPEKKLEQGNMEEAFENVDQIVEGKVHVGGQEHFYMETQRVLVIPKTEDKELDMYVS
TQDPAHVQKTVSSALNIPLSRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGRPIRL
VLDREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKL
ENAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
MYKTVDKTIYKQAFNPEPLIRCWNECLDKSSFAIRRTRVDEFNKKSYWRKRGIAVVPMKF
SVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPMSYLHTSE
TCTAAVPNTIATAASVGADVNGRAVQNACQILLKRLEPVIKKNPEGTWRDWIEAAFEQRI
SLSATGYNRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKMRTDIVMDACCS
LNPAIDVGQIEGAFIQGMGLYTTEDVHYSPEGVLYSRSPDKYKIPTVTDVPEQFNVSLLP
SSQTPLTIYSSKGLGESGMFLGSSVFFAIADAVAAARRQRDIAEDFTVKSPATPERVRMA
CADRFTDMIPRDDPKTFKPWSIPIA
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccatcccagagctccgatgagttggagttctttgtgaacgggaagaaggtg
acagagaagaatgtggacccagaagtcactctgctggccttcctgagaaagaacttacgc
ctcacggggactaagtatgcctgtgggacaggaagctgcggggcctgcactgtgatggtg
tcccagcacgatccggtgtgcaagaagacaagacacttctctgtcatggcatgcctggtg
cccctgtgctccctgcatggggctgctgtcaccaccgtggaaggtgtgggaagcatcaag
accaggctacaccccgtgcaggagagactcgccaagagccacggcacccagtgtggattc
tgcagccctgggatggtgatgtccatgtatgctctgctcaggaaccacccgcagccctca
gaggagcagctcctggaagccttgggaggtaatctctgtcggtgtactgggtatcggccg
attctggagagtggcagaaccttctgcatggagtcagatggttgtctgcagaaaggaaca
ggacagtgttgcttggatcagaaggaaggtgactcatctggaagcaaaagtgatatttgc
acggagctatttgtgaaagacgagttccagcccttggacccaacccaggagctcatattt
cccccagaactcctgaggatggctgagaacccagagaagcaaacactaaccttttatgga
gagagaattacctggatcgccccaggaaccctccaagaactcttggtgctgaaagccaag
taccctgaagcccctctcatctcaggcaacacggctctgggaccagccatgaagtctcaa
ggacacttttacccagttctcctgtcccctgctagaattcctgatctaagaatggtgact
aaaaccagtggtggactgaccataggtgcctgctgcagcctggctcaggtgaaagacgtc
ttagctgagagcatctctgagctcccagaggagaaaactcagacctaccgagctctcctg
aaacacctccgtagcttggcgggacagcagatccggaacatggcgtccttaggtggacat
gttataagcaggcattactactcggacctgaatcccatcctctctgtgggcaacgccaca
ctcaatctgctgtcagaagaaggcctgaggcagattcccctcaatggacattttcttgct
gggttggcaaatgaagacctgaagcctgaagagattctggggtcggtgtacatcccccac
tctcagaagcgggagtttgtgtctgccttccggcaggcccagtgccatcagaacgccttg
cctgatgtaaatgctggcatgagagtcctgttcaaagaaggcacagacatcattgaggag
ctgagcattgcctatggaggggtggggcccaccaccgtcagtgcacacagatcctgccag
cagctcctgggccggcgttggaacgcactgctgctagacgaggcttgcagactgctcctg
gacgaagtctccctcccaggctcagccgtgggaggcaaagtggaattcaggaggactctc
attgtcagcttcttcttcaagttctacctggaggttctacaggaactgaaggctgacaag
aggctgctccctgaatccaccgacagccagcgttatccagagatcgcagacgggtcccga
agctctctgggagatttccaggtcacgctaccccagggagtccaaacataccagagagtg
aattctcaccaacctctccaagatccagttggacgtcccatcatgcacctgtcaggtctt
aaacatgccacgggggaagctgtattttgtgatgacatccccagggtggataaagaactt
ttcatggctttagtgaccagtaccagagctcatgcaagaatcatatcgatcgactcatct
gaggtcctagacctgcctggtgtggtcgatgtgataacagctgaagacatcccgggcaac
aatggtgaagaggatgacaaattactggctgtagataaggttctctgtgtgggccaggtc
gtctgtgctgtggtagcagagactgatgttcaggcaaaacgagcaactaagaagataaaa
atcacctacgaggatctgaagcctgtgctcttcaccatcgaggatgccatacagcacaat
tcattcctgtgccctgaaaaaaagctggaacaaggaaacatggaggaggcatttgaaaat
gtggatcagatagttgaagggaaggttcatgttggagggcaagaacatttctacatggaa
acacagagagtgcttgtcattccaaagacagaagacaaagagctggacatgtatgtgtcc
acacaggatccagcccatgtgcagaaaacggtgtcctctgctttaaacatcccgctcagc
aggatcacctgccacgtgaaacgtgtgggtggaggctttggaggaaaggtggggagacca
gctgtgttcggagcaattgctgcagtgggggctgtcaaaactggccgtcccattcgtctt
gttctggaccgtgaggatgacatgttaataactgggggaagacacccattatttgcaaaa
tacaaagtgggattcatgaacagtggacgaatcaaagccctagacattgaatgctacatc
aatggaggatgcacactggatgactcggagctggtaacagaatttcttgtactaaaactg
gaaaatgcatataaaatccgcaacctcagacttcgaggtcgtgcctgcatgacaaattta
ccatccaatacagcctttcgtgggtttggcttcccacaaggagccctggtgacagaatct
tgcatcacagctgtggcagccaaatgtgggcttccaccagagaagattagggagaaaaac
atgtacaaaacagttgataaaaccatctacaaacaagcgttcaaccccgaacccctgata
aggtgctggaacgagtgtctggacaagtcttcctttgccattagaaggacaagagtggac
gagttcaataagaagagttactggaggaagagaggcattgcggtcgtccccatgaagttt
tcagttggctttgctgcgacaagctatcatcaggcagccgcgctcgttcacatctacacc
gacggctctgtgttggtggcacatggaggcaatgagctgggacaaggcattcacaccaaa
atgttacaggtggccagccgtgaattgaaaatacccatgtcgtacctgcacaccagcgaa
acatgcacagcagcggtgcccaatacaattgctacggccgcgtccgtcggagccgatgtc
aatggcagagctgtgcagaatgcctgtcagatccttctcaaacgtcttgagcccgtcatt
aagaaaaacccggaagggacatggagagactggatagaagcagcctttgaacaaaggatc
agtctttcagccaccggatacaacaggggctacaaggccttcatggactgggagaaggga
gagggagacccattcccatactatgtctatggagctgcgtgttctgaggttgaaatcgac
tgcctgacaggtgctcacaagaaaatgagaaccgacattgtcatggatgcctgttgcagc
ctgaatccagccatcgacgttgggcagatcgaaggtgcgtttattcaaggaatgggcctt
tataccacagaggacgtgcactactctccagagggcgtcctgtactctcggagcccggac
aagtacaaaatcccaactgtcactgatgtcccggagcagtttaatgtgtccttgctgcca
tcatctcagactccgctcaccatctactcgtcaaagggcctcggggagtccgggatgttc
ctagggtcatccgtatttttcgccattgctgatgcggtggctgcggcacggagacaaaga
gacatagccgaggacttcacagtgaagagcccagcaaccccagagcgggtgcggatggcc
tgtgcagaccggttcaccgacatgatcccgagagatgacccaaagacatttaaaccttgg
tctatacctatagcttaa

DBGET integrated database retrieval system