KEGG   Rattus norvegicus (rat): 316424Help
Entry
316424            CDS       T01003                                 

Gene name
Aox4, Aa2-245, Aoh2, RGD1311975
Definition
aldehyde oxidase 4 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    316424 (Aox4)
   00350 Tyrosine metabolism
    316424 (Aox4)
   00380 Tryptophan metabolism
    316424 (Aox4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    316424 (Aox4)
   00760 Nicotinate and nicotinamide metabolism
    316424 (Aox4)
   00830 Retinol metabolism
    316424 (Aox4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    316424 (Aox4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     316424 (Aox4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
9q31
AA seq 1334 aa AA seqDB search
MPSSSDELIFFVNGKKVIEKNPVPEMNLLFYVRKVLHLTGTKYSCGGGGCGACTVMISRY
NPESKKIYHYPATACLVPVCSLHGAAVTTVEGVGSIKRRIHPVQERLAKCHGTQCGFCSP
GMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVESGKTFSPESSVCQMKGSGKC
CMDLDEGCSESTKERMCTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPHKRRLTFQGERT
IWIMPVTLNGLLELKASYPEAPLVMGNTAVGPGMKFNNEFHPVFISPLGLPELNLVDTAN
SGGVTIGARHSLAQMKDILHSLTLEQPKEKTKTHQALLKHLRTLAGPQIRNMATLGGHVV
SRPDFSDLNPILAAGNATINVISKEGQRQIPLNGPFLERLPEASLKPEEVALSVFIPYSG
QWQYVSGLRLAQRQENAFAIVNAGMSVEFEEGTNTIKDLQMLFGSVAPTVVSASQTCKQL
IGRQWDDQMLSDACQLVLEEIRIPPDAEGGMVEYRRTLIISLLFKFYLKVRRWLSEMDPQ
KFPDIPEKFVSALDDLPIETPQGIQMFQCVDPNQPEQDPVGHPIMHQSGIKHATGEAKFV
DDMPRINQELCLTVVTSTRAHAKITSIDVSEALAYPGVVDVITAEDVPGDNNHSGEIFYA
QNEVICVGQIICTVAADTYIHAKEAAKRVKITYDDIEPAIITIEQALEHNSFLSSEKKIE
QGNVDYAFKHVDHIIEGEIHVEGQEHFYMETQTILAIPQTEDKEMVLHVGTQFPTHVQEY
VSAALKVPRNRIACQMKRTGGAFGGKVTKPALLGAVCAVAAHKTGRPIRFILDRSNDMLI
TAGRHPLLGKYKIGFMNNGKIKAADVEYYTNGGCTPDESEMVIEFIVLKSENAYHIPNFR
CRGRACKTNLPSNTAFRGFGFPQATVVVEAYIAAVASKCNLLPEEIREINMYKQISKTAY
KQTFNPEPLRRCWKECLQKSSFFARKQAAEEFNKNNYWKKKGLAVVPMKFSVAVPMAFYN
QAAALVHIFLDGSVLLTHGGCELGQGLHTKMIQVASRELNIPKSYVHLVETSTVTVPNAV
FTAGSMGADINGKAVQNACQTLLDRLQPIIKKNPKGKWEEWVKKAFEESISLSATGYFKG
YQTNMDWEKEEGDPYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIGQV
EGAFIQGMGFYTIEELKYSPKGVLYSRGPDDYKIPTVTEIPEEFYVTMVRSRNPIAIYSS
KGLGEAGMFLGSSVLFAIYDAVTTARKERGLSDIFPLNSPATPEVIRMACKDQFTDMIPR
DDPSTFTPWSIHVS
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgccttccagttctgacgagctgattttttttgtgaatgggaaaaaggtcatagagaag
aaccctgtccctgaaatgaatctcctgttctacgtaaggaaagttctccatctgacaggc
actaagtacagctgtggaggaggaggctgtggagcctgcactgtgatgatctcgagatac
aatcccgagtccaagaagatctaccactacccagcaactgcatgcctggtgcctgtctgc
tctctccatggggcagccgttaccacagtggaaggtgtgggaagcatcaaaaggaggatc
cacccagtgcaggaacggcttgccaagtgtcacggcacccagtgtggattctgcagccct
gggatggtgatgtccatatacacgctactcaggaaccacccggagccgacaccggaccag
atcactgaggctcttggaggaaatttgtgccgatgcactggatatcgaccgatcgtagaa
agcgggaaaacattctctccggagtcttctgtttgccaaatgaagggatctggaaaatgc
tgcatggatctagacgaagggtgttctgagagcacaaaggaaaggatgtgtactaaactg
tacaatgaggacgagttccagcccttggacccatcgcaggagcctatctttcctcctgag
ctgatcagaatggcagaggatccacacaagaggaggttgacattccaaggggagaggacc
atctggatcatgcctgtgaccttgaatggcctcctggaactgaaagccagctaccccgaa
gccccactcgtcatggggaacaccgcagtggggcccggtatgaaatttaataatgaattc
catccagtttttatatccccacttgggcttccagaactaaatcttgtggacactgcaaac
agtgggggggtgacaataggagcaaggcacagcctggcgcaaatgaaggacatcttgcat
tctctgacattggagcaaccgaaggagaagaccaaaacccatcaagctctcctgaagcat
ctgaggacacttgcagggccccagattaggaatatggctactttagggggacatgttgta
agcaggcctgatttttctgacctcaaccccattttggcagctggaaacgctaccatcaat
gtgatatctaaagaaggacaacggcagatccctttaaatggccctttccttgagcggttg
cctgaggccagcttgaaaccagaagaggttgccttgtctgttttcattccttactctggt
cagtggcagtatgtgtcaggactccggttggcccaacgtcaagaaaatgcctttgccatt
gtcaatgctggcatgagcgtggagttcgaggaaggcacaaacacgatcaaagatcttcag
atgctctttggaagtgtcgcccccactgtcgtctctgcaagccaaacctgcaagcagctc
attggacggcaatgggatgaccaaatgctgagtgacgcctgccaattggtcctggaggag
atccgcatcccgccagacgctgagggcggcatggtggagtaccgacgcaccctcatcatc
agcttgctcttcaaattttacctcaaagtgcggcgatggctcagtgaaatggatcctcag
aagtttcctgatatcccagaaaagtttgtgagtgccctagacgacctccccatagaaaca
ccccaaggaatccagatgttccagtgtgtggatcccaaccagcccgagcaagatcctgtt
gggcacccaatcatgcaccagtcaggcattaaacatgccacaggggaagctaaatttgtt
gatgacatgcctcgaattaatcaagaactctgccttaccgtcgtcacgagtaccagggcc
catgcaaagatcacgtcaattgatgtgtcagaagccctggcatatccgggtgtggttgac
gtgatcacagctgaggatgtcccaggagataataaccacagtggagagattttttatgca
cagaatgaggtcatttgtgtgggtcagatcatctgcactgtggccgctgatacctacatc
catgcaaaagaagcagctaaacgagtgaagattacttacgatgacatagagccagccatt
atcaccatagagcaagccctagaacacaactctttcctttcttctgagaaaaaaattgaa
caagggaatgtagactacgccttcaaacatgtggatcacatcattgaaggcgagatccac
gtggaaggccaggaacatttttacatggaaacacaaactatcctggctatcccacaaact
gaagacaaagaaatggtgttacatgtgggaacacaatttccaacccatgtacaggaatac
gtgtctgcagcattgaaggtcccaaggaacaggatcgcctgccaaatgaaaaggactggg
ggagcgtttgggggcaaagtgaccaagcctgctctactaggagctgtctgtgctgtggct
gcccacaagactggccgcccaatccgattcatcctagatcgaagtaatgacatgctgata
acagctggccgccacccactcctgggaaaatacaaaatcggcttcatgaataatgggaag
atcaaggctgctgacgttgaatattacaccaatggaggatgcactcccgatgaatctgag
atggtgatagaatttatcgtgctgaagtctgaaaatgcatatcatattccaaatttccgg
tgccggggcagggcttgcaaaaccaacttgccgtctaacacagctttccgaggatttggc
ttccctcaggctacagtggtagtggaagcgtacatagcggcggtggcatctaaatgtaac
ttactccctgaagagattagagaaataaacatgtacaagcaaatcagcaagacagcctat
aagcagacctttaaccctgaacctttgcgaagatgctggaaggaatgtctacagaagtca
tccttctttgctaggaagcaggctgcagaagaattcaacaaaaacaattattggaagaag
aaggggcttgcggtcgtccccatgaagtttagcgttgcagtccccatggccttctacaat
caggcagctgccctggtccacatcttcctggatggttctgtcctgctgacccatggtggc
tgtgagctgggacaaggcctacacaccaagatgattcaggtagccagtcgagaactcaac
atccccaagtcgtacgtgcaccttgttgagacgagcaccgtcacagtgcccaacgccgtc
tttaccgccggctccatgggagcagacatcaatgggaaggccgtgcagaatgcctgccag
actcttctggaccgtcttcaacctatcatcaagaaaaaccctaaaggaaaatgggaggaa
tgggttaaaaaggcctttgaagaatcgatcagtctctcggccactggatatttcaaaggc
taccagacaaacatggactgggagaaggaggaaggtgacccttacccgtactatgtctat
ggcgcagcctgctctgaggttgaagtggactgtctgaccggggctcacaagctcctgagg
actgacatcttcatggatgctgccttcagcattaaccccgccctggatatcgggcaggtt
gagggagcctttatccaaggcatgggattctataccatagaggagctgaaatactcccca
aaaggggtgctctattctcggggtccggatgactacaaaatccccactgttaccgagata
ccagaggagttctacgtcactatggtgcgctctcgaaaccccatagccatttattcatcc
aagggattgggtgaggctgggatgttcctggggtcctccgttctgtttgccatatatgat
gcagtgaccactgcccgcaaggagagagggctgagcgacatcttccccttgaatagccca
gcaacacctgaagtgattcgcatggcttgtaaggatcagtttactgacatgattcccaga
gacgacccttcaacattcacaccttggtccatccatgtgtcttaa

DBGET integrated database retrieval system