KEGG   Rattus norvegicus (rat): 317398Help
Entry
317398            CDS       T01003                                 

Gene name
Usp51, RGD1562211
Definition
ubiquitin specific peptidase 51 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq14
AA seq 696 aa AA seqDB search
MAHVREASRSSRSVACWSSGGGRGACLEQAAENASRMEQTMRGTQGAQEMKPELWPEPKP
TSENLTSRGSGSDEKVLPSIPAACHTSSSSVCPRRKPRPRPQPRSRSRGGRGLKAPPPPP
AKPPPPPPAPPPPPLPKPRPVAWRNSRRRPRPAPRPQTRKSYPSDPGCSGDSDGTENRLL
EVGFDKGPTGCSHVEIFKVAKNWRRNLRMIYQRFIWSGTPETRKRKAKTCICRVCSTHKN
RLHSCLSCVFFGCFTEKHIHIHAETKQHNLAVDLYHGVIYCFMCKDYVYDKDIEKIAKET
KEKILGLLMSTAGDMSYQQLMASEVEENQSICESKEQETSLVKPKKKRRKKTVYYTVGLR
GLINLGNTCFMNCIVQALTRIPLLKEFFLSDKHKCMMTSPSLCLVCEMSSLFQAMYSGNQ
SPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSRDDGIEQEGNLNHCNCII
DYIFTGGLQSDVTCQVCHGVSTTIDPCWDISLDLPVSYTPGRAGSTGQKPRVISLTDCLK
WFTRPEDLGSSAKIKCSRCQSYQQSTKQLTMKKLPIVACFHLKRFEHLGKQRRKINTFIS
FPLELDMTPFLASTKESIMKGQPLTECVPIENKYSLFAVINHHGTLESGHYTSFVRQEKD
QWFSCDDAVVTKATMEELLYSEGYLLFYHRQDIEKE
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgttcgagaagcgtcccggtcctcccgctccgtcgcctgttggagttcggga
ggtggtcgaggagcctgtttggagcaggcggctgagaatgcatcgagaatggagcagacg
atgcggggtacacagggagcccaggagatgaagccggagctgtggccggagcccaagccc
acgtcggagaacttaacaagtaggggcagtggcagcgatgagaaggtgctcccttctatc
ccggctgcttgtcacaccagctccagctcggtttgcccgcgccgcaagccccgccctcgg
ccccagcccaggtcccgctccaggggagggcgtgggctcaaggccccacccccgcctccc
gccaaacctccgcctcccccgccagcgccgccgccaccacccctgcccaagccgcggccg
gtggcctggcgcaattccaggcgtagacccaggcctgcacccagaccccaaacacggaaa
agctaccctagtgacccaggctgctctggggactcagatggcacagagaacaggttactg
gaggtagggtttgataagggtcccacaggctgctctcatgtagagatctttaaagtagct
aaaaactggcggaggaacctgcggatgatctatcagcgtttcatttggagtggaaccccg
gagactaggaagcgtaaggcaaagacatgcatctgtcgtgtatgtagtacgcataagaac
agactccactcttgtctgtcctgtgtatttttcggatgctttactgagaaacatattcat
attcatgcagaaactaagcaacacaatttagcagtagacctctaccatggggttatatat
tgctttatgtgtaaggattatgtatatgacaaagatatagaaaagattgccaaagaaaca
aaagagaaaattctgggactcttaatgtccactgcaggagatatgtcttatcagcaacta
atggcatctgaggttgaagaaaatcaatcaatctgtgagtccaaagaacaggagaccagt
ttggtaaaacccaagaaaaagaggaggaagaagacagtgtattatactgtaggcctcaga
gggttaattaatcttgggaatacttgctttatgaactgtattgtccaggcacttacccgc
attccactactgaaggagttcttcctttcggataagcacaaatgcatgatgacaagcccc
agcttgtgtttggtctgtgagatgtcttcactttttcaagctatgtactcggggaaccaa
agtcctcatattccctataaattgcttcacctgatatggatccatgcagagcatctagct
gggtacaggcaacaggatgctcatgagtttctgattgcaatattagatgtgttgcataga
cacagcagagatgatggcatcgagcaagaaggtaacctcaaccactgtaactgcatcata
gactacatctttacaggtggcctgcagtccgatgtcacctgtcaagtctgtcatggtgtc
tccaccactatagacccatgctgggacattagtctggacttgcctgtctcttatacccca
gggagggctggcagcacaggccagaagccacgagtcatctcacttacagattgcctgaag
tggtttacaaggcccgaagacctgggaagcagtgccaaaatcaaatgcagtcgatgccaa
agctaccagcaatctaccaaacagctcacaatgaagaaattaccgattgtggcctgcttt
catctgaaacggtttgaacatttaggcaaacagagacgcaagattaatacttttatctca
tttcctttggagctagacatgacaccctttttggcctctactaaagaaagcataatgaaa
ggccagccattaacggagtgtgtgccaattgagaataaatattctttgtttgcagtgatt
aaccaccatggtactttggaaagtggccattacaccagctttgtccgtcaggaaaaggac
cagtggttcagctgcgatgatgctgtagtcactaaggctacaatggaggagttactctat
agtgaagggtatctactgttctatcacaggcaagatatagagaaagaataa

DBGET integrated database retrieval system