KEGG   Rattus norvegicus (rat): 360471Help
Entry
360471            CDS       T01003                                 

Gene name
Usp7, Hausp
Definition
ubiquitin specific peptidase 7 (herpes virus-associated) (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    360471 (Usp7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    360471 (Usp7)
  Infectious diseases
   05168 Herpes simplex infection
    360471 (Usp7)
   05169 Epstein-Barr virus infection
    360471 (Usp7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     360471 (Usp7)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   360471 (Usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q12
AA seq 1103 aa AA seqDB search
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHSNAEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDDKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKN
SSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGSKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGDEASGRLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVNIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaacagcagcagcagcagcagcagaaagcgggcgagcagcagctgagcgag
cccgaggacatggagatggaagctggagatacagatgacccaccaagaattactcagaac
cccgtcatcaatggaaatgtagccctgagtgatgggcacagcaacgcagaggaggacatg
gaggacgacaccagttggcgctccgaggcaacctttcagttcactgtcgagcgcttcagc
agactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagatt
atggtgatgccacgcttttatccagacagaccgcaccaaaaaagcgtaggattctttctc
cagtgcaatgctgaatctgactccacgtcgtggtcctgccatgcacaagcagtgctgaag
ataataaattacagggatgacgacaagtcattcagccggcgaatcagccacttgttcttc
cacaaggaaaacgactggggattctctaatttcatggcctggagtgaagtgactgatcct
gagaaaggatttatagatgatgacaaagtcacctttgaagtttttgtacaggcggatgct
ccccatggagttgcgtgggactcaaagaagcatactggctatgtcggcttaaagaatcag
ggagcgacgtgttacatgaatagcttgctgcagaccttgtttttcacaaatcagttacga
aaggctgtgtacatgatgccaacagagggtgatgattcatctaaaagcgtccctttagca
ttgcagagagtgttctatgagttacagcacagcgataagcctgtaggaacaaaaaagctc
acaaagtcatttgggtgggaaactttagatagcttcatgcaacacgatgttcaagaactt
tgtcgagtgttgcttgataatgtggaaaataaaatgaaaggcacatgtgtagaaggcacc
attcccaagttattccgaggcaaaatggtgtcttatattcagtgcaaagaagtagactac
cgttctgataggagagaagattattatgatatccagctaagtataaaaggaaagaaaaac
atatttgaatcatttgtggattatgtggcagtagaacaactagacggtgacaataaatac
gacgctggggagcatggcctgcaggaagcagagaagggcgtgaagttcctgaccttgccc
ccagtcttacacctgcagctcatgcggttcatgtacgaccctcagacggaccaaaacatc
aagatcaatgacaggtttgagtttccagaacagttaccacttgatgaatttttgcaaaaa
acggaccctaaggaccctgcaaattatattctccatgcagtcttggttcacagtggagat
aatcatggtggacattacgtggtttacctaaaccccaaaggggatggcaaatggtgtaaa
tttgatgatgatgtggtatccaggtgtactaaagaagaagcaatcgagcacaattatggg
ggtcatgatgacgatctatctgttcgacactgcacaaatgcctatatgttagtgtacatc
agggaatcaaagctgagtgaggtgttgcaagctgtcaccgaccatgatattcctcagcag
ttggtggaacgtttgcaagaagagaaaaggatcgaggctcagaagcggaaggagcggcag
gaagcccatctctacatgcaagtgcagatagttgcagaggaccagttttgtggccaccaa
ggaaatgacatgtacgacgaggagaaagtgaggtacaccgtgttcaaggttctgaagaac
tcctccctggccgagtttgttcagagcctctcgcagaccatggggtttccacaagatcag
attcgattatggcctatgcaagcaaggagtaacgggacaaagcggcctgcaatgttagat
aatgaagccgacggcagcaaaacaatgattgaactgagtgataatgaaaacccttggaca
atattcctggaaacagttgaccctgagctggctgctagtggagcaacactgcccaagttt
gataaagatcatgatgtaatgttatttttgaagatgtatgatcctaaaacacggagcttg
aattactgtggacacatctacacacccatatcctgtaaaatacgtgacttgctcccggtt
atgtgtgacagagcaggatttatccaggatactagccttatcctctatgaggaagttaag
ccgaatttaacagagagaattcaggactatgatgtgtctcttgataaagccctcgatgag
ctgatggatggtgacatcatcgtgtttcagaaggatgacccggaaaacgataacagtgag
ctacccactgctaaggagtacttcagagacctctaccatcgcgtcgacgtcatcttctgt
gacaaaacgatccctaatgaccctgggtttgtggtcaccttatcaaataggatgaattat
tttcaggttgcaaagacagttgcacagaggctcaacacagaccccatgttgcttcagttt
ttcaagtctcaaggttatagggacggccccggtaatccccttaggcataattacgaaggt
actttaagagatcttctacaattcttcaagccaagacaacctaagaaactttactatcag
cagcttaagatgaaaatcacggactttgagaacaggagaagttttaagtgtatatggtta
aacagccaatttagggaagaggaaataacactatacccagacaagcatggctgtgtccgg
gacctgttagaagaatgtaaaaaagccgtggagcttggtgacgaagcatcagggagactt
aggctgctagaaattgtgagctacaaaattattggtgtgcaccaagaagatgaactatta
gagtgcttatctcctgcaacgagtcggacttttagaatagaggaaatacctttggaccag
gtaaacatcgataaggaaaacgagatgctaatcacggtggcgcatttccacaaagaagtg
tttgggacattcggaattccgtttttgctgaggatacaccagggtgagcatttcagagaa
gtgatgaagcggattcagagcctgctggatatccaggaaaaggagtttgaaaagtttaaa
ttcgcaattgtcatgatgggccggcaccagtacatcaatgaagatgagtatgaagtgaat
ttgaaggactttgagccacaacctggtaacatgtctcatcctcggccttggctagggctt
gaccacttcaacaaagccccaaagaggagtcgctacacttacctagaaaaggcaattaaa
atccacaactga

DBGET integrated database retrieval system