KEGG   Rattus norvegicus (rat): 360471Help
Entry
360471            CDS       T01003                                 

Gene name
Usp7, Hausp
Definition
ubiquitin specific peptidase 7 (herpes virus-associated) (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:rno04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:rno05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:rno05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q12
AA seq 1103 aa AA seqDB search
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHSNAEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDDKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKN
SSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGSKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGDEASGRLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVNIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaacagcagcagcagcagcagcagaaagcgggcgagcagcagctgagcgag
cccgaggacatggagatggaagctggagatacagatgacccaccaagaattactcagaac
cccgtcatcaatggaaatgtagccctgagtgatgggcacagcaacgcagaggaggacatg
gaggacgacaccagttggcgctccgaggcaacctttcagttcactgtcgagcgcttcagc
agactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagatt
atggtgatgccacgcttttatccagacagaccgcaccaaaaaagcgtaggattctttctc
cagtgcaatgctgaatctgactccacgtcgtggtcctgccatgcacaagcagtgctgaag
ataataaattacagggatgacgacaagtcattcagccggcgaatcagccacttgttcttc
cacaaggaaaacgactggggattctctaatttcatggcctggagtgaagtgactgatcct
gagaaaggatttatagatgatgacaaagtcacctttgaagtttttgtacaggcggatgct
ccccatggagttgcgtgggactcaaagaagcatactggctatgtcggcttaaagaatcag
ggagcgacgtgttacatgaatagcttgctgcagaccttgtttttcacaaatcagttacga
aaggctgtgtacatgatgccaacagagggtgatgattcatctaaaagcgtccctttagca
ttgcagagagtgttctatgagttacagcacagcgataagcctgtaggaacaaaaaagctc
acaaagtcatttgggtgggaaactttagatagcttcatgcaacacgatgttcaagaactt
tgtcgagtgttgcttgataatgtggaaaataaaatgaaaggcacatgtgtagaaggcacc
attcccaagttattccgaggcaaaatggtgtcttatattcagtgcaaagaagtagactac
cgttctgataggagagaagattattatgatatccagctaagtataaaaggaaagaaaaac
atatttgaatcatttgtggattatgtggcagtagaacaactagacggtgacaataaatac
gacgctggggagcatggcctgcaggaagcagagaagggcgtgaagttcctgaccttgccc
ccagtcttacacctgcagctcatgcggttcatgtacgaccctcagacggaccaaaacatc
aagatcaatgacaggtttgagtttccagaacagttaccacttgatgaatttttgcaaaaa
acggaccctaaggaccctgcaaattatattctccatgcagtcttggttcacagtggagat
aatcatggtggacattacgtggtttacctaaaccccaaaggggatggcaaatggtgtaaa
tttgatgatgatgtggtatccaggtgtactaaagaagaagcaatcgagcacaattatggg
ggtcatgatgacgatctatctgttcgacactgcacaaatgcctatatgttagtgtacatc
agggaatcaaagctgagtgaggtgttgcaagctgtcaccgaccatgatattcctcagcag
ttggtggaacgtttgcaagaagagaaaaggatcgaggctcagaagcggaaggagcggcag
gaagcccatctctacatgcaagtgcagatagttgcagaggaccagttttgtggccaccaa
ggaaatgacatgtacgacgaggagaaagtgaggtacaccgtgttcaaggttctgaagaac
tcctccctggccgagtttgttcagagcctctcgcagaccatggggtttccacaagatcag
attcgattatggcctatgcaagcaaggagtaacgggacaaagcggcctgcaatgttagat
aatgaagccgacggcagcaaaacaatgattgaactgagtgataatgaaaacccttggaca
atattcctggaaacagttgaccctgagctggctgctagtggagcaacactgcccaagttt
gataaagatcatgatgtaatgttatttttgaagatgtatgatcctaaaacacggagcttg
aattactgtggacacatctacacacccatatcctgtaaaatacgtgacttgctcccggtt
atgtgtgacagagcaggatttatccaggatactagccttatcctctatgaggaagttaag
ccgaatttaacagagagaattcaggactatgatgtgtctcttgataaagccctcgatgag
ctgatggatggtgacatcatcgtgtttcagaaggatgacccggaaaacgataacagtgag
ctacccactgctaaggagtacttcagagacctctaccatcgcgtcgacgtcatcttctgt
gacaaaacgatccctaatgaccctgggtttgtggtcaccttatcaaataggatgaattat
tttcaggttgcaaagacagttgcacagaggctcaacacagaccccatgttgcttcagttt
ttcaagtctcaaggttatagggacggccccggtaatccccttaggcataattacgaaggt
actttaagagatcttctacaattcttcaagccaagacaacctaagaaactttactatcag
cagcttaagatgaaaatcacggactttgagaacaggagaagttttaagtgtatatggtta
aacagccaatttagggaagaggaaataacactatacccagacaagcatggctgtgtccgg
gacctgttagaagaatgtaaaaaagccgtggagcttggtgacgaagcatcagggagactt
aggctgctagaaattgtgagctacaaaattattggtgtgcaccaagaagatgaactatta
gagtgcttatctcctgcaacgagtcggacttttagaatagaggaaatacctttggaccag
gtaaacatcgataaggaaaacgagatgctaatcacggtggcgcatttccacaaagaagtg
tttgggacattcggaattccgtttttgctgaggatacaccagggtgagcatttcagagaa
gtgatgaagcggattcagagcctgctggatatccaggaaaaggagtttgaaaagtttaaa
ttcgcaattgtcatgatgggccggcaccagtacatcaatgaagatgagtatgaagtgaat
ttgaaggactttgagccacaacctggtaacatgtctcatcctcggccttggctagggctt
gaccacttcaacaaagccccaaagaggagtcgctacacttacctagaaaaggcaattaaa
atccacaactga

DBGET integrated database retrieval system