KEGG   Rattus norvegicus (rat): 360518Help
Entry
360518            CDS       T01003                                 

Gene name
Gfpt2
Definition
glutamine-fructose-6-phosphate transaminase 2 (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rno00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rno00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 682 aa AA seqDB search
MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNHEVKERHIHLVKKK
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNVVNSHPQRSDKDNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTCTIENVKNICKTRLK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQTRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctttgcctatatgaattacagagttcccaagacgaggaaggagattttt
gaaaccctcatcaggggcctgcagcggctggagtaccggggttatgactcggcaggtgtg
gccattgacgggaataaccatgaagtcaaagaaagacacatccatcttgtgaagaagaag
ggaaaagtgaaggctctggatgaagaactttacaagcaagatagcatggacttgaaggta
gagtttgagacacacttcggcatagcccacacacgttgggccacccatggggtccccaat
gtggtcaacagtcacccacagcgttcagacaaagacaatgaatttgtcgtcatccacaac
ggaatcatcactaattacaaggatctaaggaaatttctggaaagcaagggctacgagttt
gagtcagaaacagacacggagaccatcgccaagctgattaaatacgtattcgacaacaga
gagactgaggacattacgttttccacattggtcgaaagagtcattcagcagttggaaggc
gcctttgccctggtcttcaagagcatccactacccgggagaagctgttgccacaaggaga
ggcagccccctgctcatcggggtacgaagcaaatacaaactctccacagagcagatcccc
gtcttatatcggacatgcactattgagaatgtgaagaatatctgtaagaccaggctgaag
agactggacagctccacctgcctgcatgcagtgggggataaagccgtggagttcttcttt
gcttctgatgcaagtgccatcatagaacacaccaaccgggtcatcttcttagaagatgat
gatattgctgcagtggctgatgggaaactctccattcaccgagtcaaacgctcagctagt
gatgacccctcccgagccatccagaccttgcagatggaactacagcaaataatgaaaggt
aacttcagtgcatttatgcagaaggagatcttcgagcagccagaatctgtttttaatacc
atgagaggtcgggtaaattttgagaccaacacagtgctcctgggtggcttgaaggaccat
ttgaaggagattcgtcgatgccgaaggctcattgtgataggctgtggaaccagctaccat
gccgctgtggctacacggcaagtgttagaggaactgaccgagctccctgtgatggttgaa
cttgccagtgactttctggacaggaacacacctgtgttcagggatgatgtttgctttttc
ataagccagtcaggagagactgcagacacgctcctggcgctgcgatactgtaaggatcgc
ggtgcgctgaccgtgggcatcaccaacaccgtgggcagctccatctcccgagagaccgac
tgtggcgtccacatcaacgcagggcccgagattggggtggctagcaccaaggcctacacc
agccagttcatctctctggtgatgtttggtttgatgatgtctgaagatcgaatttctcta
cagaccaggagacaagagatcatccgtggcctcagatctttacctgagctgatcaaagaa
gtattatccctggatgagaagatccacgacttggccctggagctctacacacagaggtca
ctcctagtgatgggacgaggatataactatgccacatgcctggaaggtgccttgaaaatt
aaagagataacctacatgcattcagaaggtatcctggccggagagctgaagcacgggccc
cttgctctcgtcgacaagcagatgccagtcatcatggtgatcatgaaggatccttgcttt
gccaagtgccagaatgccctgcagcaggtcactgcccgccagggtcgcccaatcattctg
tgctccaaggatgacacggagagttccaagtttgcatataaaaccattgaacttccccac
acggtggactgtctccagggtatcctgagcgtgattccactccagcttctgtccttccac
ctggctgtcctccgaggttatgatgttgacttcccgagaaacctagccaagtctgtcact
gtggaatga

DBGET integrated database retrieval system