KEGG   Rattus norvegicus (rat): 360518Help
Entry
360518            CDS       T01003                                 

Gene name
Gfpt2
Definition
(RefSeq) glutamine-fructose-6-phosphate transaminase 2 (EC:2.6.1.16)
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    360518 (Gfpt2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    360518 (Gfpt2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    360518 (Gfpt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     360518 (Gfpt2)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C44
   360518 (Gfpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 682 aa AA seqDB search
MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNHEVKERHIHLVKKK
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNVVNSHPQRSDKDNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTCTIENVKNICKTRLK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQTRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctttgcctatatgaattacagagttcccaagacgaggaaggagattttt
gaaaccctcatcaggggcctgcagcggctggagtaccggggttatgactcggcaggtgtg
gccattgacgggaataaccatgaagtcaaagaaagacacatccatcttgtgaagaagaag
ggaaaagtgaaggctctggatgaagaactttacaagcaagatagcatggacttgaaggta
gagtttgagacacacttcggcatagcccacacacgttgggccacccatggggtccccaat
gtggtcaacagtcacccacagcgttcagacaaagacaatgaatttgtcgtcatccacaac
ggaatcatcactaattacaaggatctaaggaaatttctggaaagcaagggctacgagttt
gagtcagaaacagacacggagaccatcgccaagctgattaaatacgtattcgacaacaga
gagactgaggacattacgttttccacattggtcgaaagagtcattcagcagttggaaggc
gcctttgccctggtcttcaagagcatccactacccgggagaagctgttgccacaaggaga
ggcagccccctgctcatcggggtacgaagcaaatacaaactctccacagagcagatcccc
gtcttatatcggacatgcactattgagaatgtgaagaatatctgtaagaccaggctgaag
agactggacagctccacctgcctgcatgcagtgggggataaagccgtggagttcttcttt
gcttctgatgcaagtgccatcatagaacacaccaaccgggtcatcttcttagaagatgat
gatattgctgcagtggctgatgggaaactctccattcaccgagtcaaacgctcagctagt
gatgacccctcccgagccatccagaccttgcagatggaactacagcaaataatgaaaggt
aacttcagtgcatttatgcagaaggagatcttcgagcagccagaatctgtttttaatacc
atgagaggtcgggtaaattttgagaccaacacagtgctcctgggtggcttgaaggaccat
ttgaaggagattcgtcgatgccgaaggctcattgtgataggctgtggaaccagctaccat
gccgctgtggctacacggcaagtgttagaggaactgaccgagctccctgtgatggttgaa
cttgccagtgactttctggacaggaacacacctgtgttcagggatgatgtttgctttttc
ataagccagtcaggagagactgcagacacgctcctggcgctgcgatactgtaaggatcgc
ggtgcgctgaccgtgggcatcaccaacaccgtgggcagctccatctcccgagagaccgac
tgtggcgtccacatcaacgcagggcccgagattggggtggctagcaccaaggcctacacc
agccagttcatctctctggtgatgtttggtttgatgatgtctgaagatcgaatttctcta
cagaccaggagacaagagatcatccgtggcctcagatctttacctgagctgatcaaagaa
gtattatccctggatgagaagatccacgacttggccctggagctctacacacagaggtca
ctcctagtgatgggacgaggatataactatgccacatgcctggaaggtgccttgaaaatt
aaagagataacctacatgcattcagaaggtatcctggccggagagctgaagcacgggccc
cttgctctcgtcgacaagcagatgccagtcatcatggtgatcatgaaggatccttgcttt
gccaagtgccagaatgccctgcagcaggtcactgcccgccagggtcgcccaatcattctg
tgctccaaggatgacacggagagttccaagtttgcatataaaaccattgaacttccccac
acggtggactgtctccagggtatcctgagcgtgattccactccagcttctgtccttccac
ctggctgtcctccgaggttatgatgttgacttcccgagaaacctagccaagtctgtcact
gtggaatga

DBGET integrated database retrieval system