KEGG   Rattus norvegicus (rat): 360643Help
Entry
360643            CDS       T01003                                 

Gene name
Cdc27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    360643 (Cdc27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    360643 (Cdc27)
   04114 Oocyte meiosis
    360643 (Cdc27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    360643 (Cdc27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    360643 (Cdc27)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     360643 (Cdc27)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     360643 (Cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.1
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTALVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDNVPLGTGPSILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPTKKSVARMGHTGAKSVFSQSGNSREATPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcactaaaccactatgct
taccgagacgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttctactggcgacctgttactaccgctcaggaaaggcctataaagcctatagactc
ttgaaaggacacagttgtaccaccccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcaa
aaaagccatgacgaccttgtcactgagtttggtgattcagcttgcttcactctttccttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacgtgtacagctctagtatctaaccacagtttatctcacagacagcctgagaca
gtccttacagaaactccccaagacacgattgaattaaacagactgaacttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcagctgtaatt
tcaccagataacgtcccccttggaactggtccttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgacgtgccatccaccggagcacctactaaaaagtcc
gttgcaagaatgggccacactggagcgaagtctgtcttctcacagagtgggaacagtcgg
gaggccacaccggtgctcgttgcccagacacaaagctctggcccacaaacaagtacaaca
cctcaggtattgagccccactattacatctcccccaaatgcattgcctcgaagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacccaacataaacgatagtctggaaattacaaaattggactcttctatcatttcagaa
gggaaaatatccacaatcacacctcagatccaggcatttaacctacaaaaggcagcagca
ggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattctgagccacctaccttctcaccactacagtactggctgg
gtcctgtgccagattggacgggcttattttgaactttcagaatacatgcaggctgaaaga
atattctcagaagttagaaggattgagagtttcagagttgagggtatggagatctactct
acaacactctggcatcttcagaaagatgttgctctttcggttctttcaaaagatttaaca
gacatggataagaattcaccagaggcttggtgtgctgcagggaattgtttcagtctacaa
cgggagcatgatatagcaattaaattcttccaaagagctatccaggtggatccaaattat
gcttatgcctatactctattaggacatgaatttgtgttaactgaagaactagataaagca
ttagcatgttttcgaaatgctataagagtaaatcccagacattataatgcatggtatggt
ttagggatgatttattacaagcaagagaaattcagcctcgcagaaatgcatttccagaaa
gcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcagcat
gcactcaagaagtctgagaaggctttggataccctaaacaaagccattgttatagatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatacaag
tctgctttacaagaacttgaagaactgaaacagattgtccccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaattgac
aagcgctaccttccagatgatgaggagccgataacccaggaggagcagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagatgacactcaacttcatgcagcggaa
agtgatgaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system