KEGG   Rattus norvegicus (rat): 360753Help
Entry
360753            CDS       T01003                                 

Gene name
Pnpla6, RGD1564611
Definition
patatin-like phospholipase domain containing 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    360753 (Pnpla6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     360753 (Pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
12p12
AA seq 1366 aa AA seqDB search
MGTPSHELNTTSSGSEVIRKALEEGLGRRICVAQPVPFVPQVLGVMIGAGVAVLVTAVLI
LLVVRRLRVQKTPAPEGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVSTTSRPRMK
KKLKMLNIAKKILRIQKETPTLQRKEPPPSVLEADLTEGDLANSHLPSEVLYMLKNVRVL
GHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKECVVKE
VVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVV
QIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKRVVSTSGT
EDTPKETSGRPLDPTGAPLPGPAGDPVKPTSLEAPSAPLLSRCISMPVDISGLQGGPRSD
FDMAYERGRISVSLQEEASGGPQTASPRTPTQELREQPAGACEYSFCEDESATGGCPFGP
YQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHFVLWG
CLHVYQRMIDKAEEVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSDFYEI
MRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIVLNGRLR
SVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRY
PQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLSVPQHSELTNPASNLSTVAILPVCAEVP
MMAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAHRIVLYQ
TDTSLTPWTVRCLRQADCILIVGLGDQEPTVGQLEQMLENTAVRALKQLVLLHREEGPGP
TRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRLARVLT
GNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQR
AREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNVTTDITA
SAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMGAKTVI
AIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVV
KSSSYCEYLRPSIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWTRGEVIEKMLTDRRSTDL
NESRRADILAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRD
EGGSPEGASPSTASEVVRMEPKDHMSPADHMCRGKELDRALGVGAG
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggggacaccgagtcacgagctgaatacgacctcctccgggtcagaggtgattcgaaag
gccctggaggagggcttggggcgacggatatgcgttgcccagcctgtgccgttcgttccg
caggtgctgggcgtgatgatcggggccggagtggcggtgctggtcaccgccgtactcatc
ctcttggtggtgcgaaggctacgggtgcaaaaaactccagccccggagggtccccggtat
cggttccggaagcgggacaaagtgcttttctatggccggaagattatgcggaaggtgtca
caatccacttcttccctggtggacacatcagtctccaccacttcccgaccccgcatgaag
aagaaactgaagatgcttaacattgccaagaagatcttgcggatccaaaaggagaccccg
accctacaacggaaggagcccccaccttcagtgctggaggctgacctcacagagggtgac
ctggccaattcccacctaccctctgaggtgctctacatgcttaagaatgttcgggtgctg
ggtcactttgagaagccactcttcctggagctctgccggcacatggttttccagcgtctt
gggcagggggactacgtttttcggcctggtcagccagatgccagcatctacgtggttcag
gatgggctgctggagctctgtctaccgggccctgatgggaaggagtgcgtggtgaaggaa
gtggtccctggagacagcgtcaacagccttctgagcatccttgatgtcatcacgggtcac
cagcatccccagcggactgtttcggctcgggctgcacgggactccacagtgctgagactc
cccgtggaagccttctcagccgtcttcaccaagtaccctgagagtctggtgcgagtagtg
cagatcatcatggtgaggctgcagagggtcaccttcctggcccttcacaattacctgggt
ctgaccaatgaactcttcagccacgagatccagcccctacgcttgttccccagccctggc
ctcccgacccgaaccagccctgtccgtggctctaaacgggtagtcagtacctcaggtacc
gaggacaccccgaaggagacctctggccggccccttgaccccactggagcgccactgcct
ggacctgcaggggatcctgtgaagcccacatccttagaagcgccctcagcccccctactg
agccgctgcatctccatgccagtggacatctcaggcttgcaaggtggccctcgttctgac
tttgacatggcctatgaacgtggccggatatctgtttcccttcaagaagaggcctctgga
ggccctcagacagcatcccctaggacccccactcaggagctccgggagcagccagcaggc
gcctgtgaatatagcttctgtgaggatgagtcagccacaggtggatgtccctttgggccc
taccagggccgccagacaagcagcatctttgaggctgcgaagagagaactagccaagctg
atgcggattgaggacccctctctactgaatagcagagtcttgctacatcatgccaaagcc
ggcaccatcatagctcgccagggggaccaggatgtgagcctgcactttgtgctctggggc
tgcctgcatgtgtaccaacgcatgattgacaaggccgaggaggtgtgcctgtttgtggca
cagccaggggagctggtggggcagctggcggtgctcaccggggaacccctcatcttcaca
ctccgtgcccaaagagactgcaccttcctccggatctccaaatccgacttctatgagatc
atgcgtgcacagcccagtgtggtgctcagcgcagctcacacggtggctgctaggatgtcc
cccttcgtgcgccagatggactttgccattgactggacagctgtggaggctggtcgcgcg
ctctacaggcagggcgaccgttcagactgcacctacattgtactcaatgggcgtctccgc
agtgtcatccaacgaggcagtggcaagaaggagctagttggggagtatggccgaggggat
ctcattggtgtggtggaggcattgacccggcagccacgggccaccactgtacacgctgtg
cgagacacagagctggccaagctccccgagggcaccttaggtcacatcaaacgtcggtac
ccacaggtcgtgactcgccttattcatctgctaagccagaaaattctgggcaatctgcag
cagttgcaaggaccctttccagcaggctccggactcagtgtcccgcagcactcagagctg
accaacccagccagcaacctgtccactgtggctatcctccctgtgtgtgctgaggtgccc
atgatggcctttactctggaacttcagcatgccctgcaagctattggtcccacgctcctc
cttaacagtgacatcatccgggcacgcctgggggcttcagcgctggatagcattcaagaa
ttccggctgtcagggtggctggctcagcaggaagatgcccatcgaattgtactctaccaa
actgacacgtccctgacgccttggaccgtccgttgcctccgccaggccgactgcatcctc
attgtgggcctgggggaccaggaacccactgtcggtcagctggaacaaatgctggagaac
actgccgtgcgtgccttgaagcagctggttttgctgcaccgggaggaaggccctgggccc
acgcgcactgtagagtggctcaacatgcgcagctggtgctctggacacctgcacctccgc
tgtcctcgccgcctcttctcgcgtcgcagcccagctaaacttcatgagctgtatgagaag
gttttctccaggcgtgcagaccgtcacagcgacttctcccgcctggcacgagtgctcaca
ggaaacactattgctctggtgctgggtggaggcggggccaggggctgctcgcatattggg
gtgctgaaggcattagaggaggcaggggtcccagtcgaccttgtgggaggcacatctata
ggttccttcattggggccctgtatgccgaggaacgcagcgccagtcgtaccaaacagcga
gcccgggagtgggccaagagcatgacttctgtactggagcctgtattggacctcacatat
cctgtcacctccatgtttactggctcggcctttaaccgaagtatccaccgtgtcttccag
gacaagcagatcgaggacctgtggctgccttacttcaatgtgaccacagacatcactgca
tccgccatgcgtgtccacaaagatggctccctgtggcgctatgtgcgtgccagcatgacg
ctctcgggctacctgcccccgctgtgcgacccgaaggatgggcacctgctcatggatggt
ggctacatcaacaacctgccagcggatatcgcccgcagcatgggggccaaaacggtcatt
gccatcgacgtgggaagccaggatgagacggatctcagcacctatggggacagcctgtct
ggctggtggttgctgtggaaacggctaaacccctgggcagacaaggtaaaggttccagac
atggctgagatccagtcccgcctggcgtatgtgtcctgtgtgcggcagctggaagttgtc
aagtctagttcctattgcgagtaccttcgtccatccattgactgcttcaagaccatggac
ttcgggaagtttgaccagatctatgatgtgggttaccagtatgggaaggctgtgtttgga
ggctggacccgtggtgaagtcattgagaaaatgctcacagaccggaggtctacagacctt
aatgaaagtcgccgtgcagatatacttgccttcccgagctctggcttcactgacttggct
gagatcgtgtcccggattgagcccccaacaagctacgtctctgatggctgtgctgatggg
gaggagtcggattgcttgacagagtatgaggaagatgcgggacctgactgctcaagggat
gaagggggctctcctgagggtgccagccctagcactgcctcagaggtggtaagaatggag
cccaaagatcacatgtccccagcagatcacatgtgccgtgggaaggaactagatagagcc
ttgggggttggtgctgggtga

DBGET integrated database retrieval system