KEGG   Rattus norvegicus (rat): 360763Help
Entry
360763            CDS       T01003                                 

Gene name
Usp12
Definition
ubiquitin specific peptidase 12 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     360763 (Usp12)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   360763 (Usp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12p11
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFRDKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLRNGDVDSEDNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaattcgcctccatctgtaccatgggcgccaatgcc
tcggcattagagaaagagattggtccagaacagtttccggtcaacgagcactattttgga
ttagtcaattttgggaatacctgctactgcaactccgttctccaagcactttatttttgt
cgtccgtttcgggacaaagttctggcatacaagagtcagcccagaaaaaaggaaagcctc
ctcacctgcctggcagacctcttccacagcatagccacccagaagaagaaggtcggcgtg
atcccgcccaagaagttcatcaccagattgcggaaggaaaacgagctgtttgataactac
atgcaacaagatgcccatgaattcttaaattacctactcaatacaattgctgatattcta
caagaagaaagaaagcaggagaagcaaaatggccgattacgtaacggggatgtggacagc
gaggataacaacagcacaccagacccaacgtgggtccacgagatttttcagggaacatta
actaatgaaaccaggtgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcaatcactcactgcctaagagggttcagt
aacacggagactctgtgcagtgaatacaaatactactgtgaagaatgccggagcaagcag
gaggcacacaaacggatgaaagttaagaaactacccatgatcctggctctgcacctgaag
aggtttaagtacatggaccagcttcatcgatatacaaagctttcttaccgggtggtgttt
cctttagaactccgtctgtttaacacttcaggagacgcaaccaaccctgacagaatgtat
gacctggtcgctgttgtggttcactgtggaagtggtcccaatcgaggccattatattgca
atagttaagagtcatgatttttggttgttatttgatgacgacattgtagaaaaaatagac
gcacaagctattgaagaattctacggactgacatctgacatctccaagaactctgagtct
gggtacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system