KEGG   Rattus norvegicus (rat): 360853Help
Entry
360853            CDS       T01003                                 

Gene name
Uchl5
Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     360853 (Uchl5)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   360853 (Uchl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q21
AA seq 324 aa AA seqDB search
MSSNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKIFSCRGRNL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaatgccggggagtggtgtctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagctcaagtagaagaaatatggagcttagagcct
gagaatttcgaaaagctaaagccggttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagctggctctgtggttcaggactccagacttgaaacaatattttttgct
aagcaggtaattaataatgcttgtgccacgcaggctatcgtaagtgtactactgaactgt
acccatcaagatgtccatttaggagagacattatcagaatttaaggaattttcccaaagt
tttgatgcagctatgaaggggttggcattgagtaactcagatgtgattcgacaagtgcac
aacagttttgccagacagcagatgtttgaatttgatacaaagacatcagccaaagaagaa
gatgcttttcactttgtcagttatgttccagttaatggaagactgtatgaattagatgga
ttaagagaaggcccaattgatttaggtgcatgcaatcaggatgactggattactgcagtg
aggccagtaatagagaagaggattcaaaagtatagtgaaggagaaattcgatttaattta
atggccattgtatctgacagaaaaatgatatatgaacagaagatagcagagttacagaga
cagcttgcagaggaggaacccatggatacagatcagggtagtactgtgttaagtgctatt
cagtcagaagttgccagaaaccagatgcttattgaagaagaggtacaaaagttaaaaaga
tataagattgaaaatatcagaaggaagcataactacctgcctttcattatggaattgtta
aagaccttagcagaacaccagcagttaattccacttgtggaaaagatattctcatgtagg
ggaaggaatctttaa

DBGET integrated database retrieval system