KEGG   Rattus norvegicus (rat): 360962Help
Entry
360962            CDS       T01003                                 

Gene name
Tacc3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    360962 (Tacc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
14q21
AA seq 585 aa AA seqDB search
MSLHILTDENVPNEKSSESRDFLFSAPELTGRSSVLRLSQKENVPPKNQAKAAKVTFQTP
LRDPQTHRILSPNMTSKLEAPFALDDSVGLQNDHCVFLQKENQLPVAPVDDVPVVQMAAE
ILKAEDELQEGILNSLSPSAFTSFPDGELVTPPIEPMPEPSPQGPEPLLDSEPVTPPVKP
VLEPTPQGPEPLLDSEPVTPPVKPVLEPTPQGSEPLLDSEPVTLPVEPVPESSHQGPEPL
LDSEPVTLPVEPVPESSHQGPEPLLDPKEESFRDPAEVLGAGAEVDYLEQFGTSSFKESA
WRKQSLYLKFDPLLKESPLRSMPVPVAPVTNSTQDTEESGSGNPTEAKLVDLDFLGGLDV
PVSAPPLCVLEPRGLLPAEPIVDVLKYSQKDLDAVVMQQENLELRNKYEDLNTKYLEMGR
SLMDLRKIVYKSMEEAEKQKELAEDKIQKILRERDQLTADLNSMEKSFSDLFKRFEKQKE
VIEGYQKNEDSLKKCVEDYIVKIGKEGQRYQALKAHAEEKLKMANEEIAQVRSKAQAEAL
ALQASLRKAQLQIQSLEKTVEQKTKENDELNRICDELIAKMEKKI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcatatcttaactgacgaaaatgtccccaacgagaagagttcagaaagccgt
gacttcctgttttcagcaccagaacttaccggaagatcctctgttcttcgcctgtcacag
aaagaaaatgtacctcccaagaaccaggctaaagccgcaaaggtgacttttcagacacct
cttcgggatccacagacacacaggatcttaagtcctaatatgaccagcaaacttgaggct
ccttttgctctggatgacagtgttggattacaaaatgaccactgtgtcttcttacagaaa
gagaaccagctgccggtagccccagtggacgatgtacctgtggttcagatggcagccgag
atcctgaaagcagaggacgagttacaggagggaattttgaattccttgagcccttcagct
ttcacaagttttccagacggtgagctggtaacccctccaatcgagccgatgccggagcct
tcccctcaggggccagagcctctcttggacagcgagccagtgacccctccagtcaagcca
gtgctggaacctactcctcaggggccagagcctctcttggacagtgagccggtgacccct
ccagtcaagccagtactggaacctacccctcagggatcagagcctctcttggacagtgag
ccagtgacccttcctgttgaaccagtgccagagtcttcccatcagggaccagaacctctc
ttggacagtgagccagtgacccttcctgttgaaccagtgccagagtcttcccatcaggga
ccagaacctctcttggacccaaaggaagagagctttagagacccagcagaagttctaggt
gctggtgctgaagtggattatctggagcaatttggaacttcctcgttcaaggagtcagcc
tggaggaagcagtctttgtacttgaaatttgacccccttctgaaagagagccctttgcgg
tcaatgccagtgccagtggccccagtgacaaatagtacacaggatacagaggagtctggc
tccggaaatccaacagaagccaagctcgtcgacttagatttcttgggaggtctggatgtt
cctgtgtcggccccacccctgtgtgtccttgagcctcgaggtctccttcctgccgagcct
attgtggacgtgctgaaatacagtcagaaagacctggatgcagtggtgatgcagcaggag
aacttggagctgagaaacaaatatgaggacctcaacacgaagtatctggagatgggaaga
tcgttgatggatttgagaaagatcgtgtataaatcaatggaggaggctgagaaacagaag
gaactagctgaagacaaaattcaaaagattttaagagagagagaccaacttactgcggat
ctgaactctatggagaagtccttctctgacctcttcaagcggtttgagaagcagaaggaa
gtgattgaaggctaccagaagaatgaagattcactgaagaagtgtgttgaggattacata
gtgaagattggaaaagaaggccagaggtaccaggcgctgaaggcccacgcagaagaaaaa
ctcaagatggcaaatgaagagatcgcccaagtgcgaagcaaggcccaagcagaggcactg
gctctccaggcaagcctgaggaaggcacagttgcagatccagtcactggagaagactgtg
gagcagaagactaaagagaacgatgaactgaacaggatctgcgatgaactcattgctaag
atggagaagaagatctga

DBGET integrated database retrieval system