KEGG   Rattus norvegicus (rat): 360990Help
Entry
360990            CDS       T01003                                 

Gene name
Usp34
Definition
ubiquitin specific peptidase 34 (EC:3.4.19.12)
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
14q22
AA seq 3583 aa AA seqDB search
MCENCADLVEVLNEISDLEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTTNTDSTWQDESNEAEEPLSIDRECNEGHTERQK
SIEKKSNSTGICNLTEEESSKSSDPFSLWNTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNSVIEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNMPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGASDIEMD
EQLINRNKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGQSDGSSHEVNSSHASQ
SAGSPGSELQSEDIADIEALKEEEEEEEEEEEEEEEEEEDEEEEEDDEEEDDDDDDDDHA
HNPPKNTCGTEMRNRKLENQAAICLGESQATSERNGTHGGAGKDLVFNTEPLPSVDNRIR
MLDACAHSEDPEHDISGEMSSAHIAQGSQESCITRSGDFLGETIGNELFNCRQFIGPQHH
HHHHHHHHHHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGC
EEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKHQFSSNAVTDINLDNVCKKG
NTLLWDIVQDDDAINLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVI
SLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQGIREGRQKHTLYS
HSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSK
DQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMD
QFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSSLEQESHS
SLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAG
LPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQEFGQSSRKGEFPGGLMGPV
RMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNI
PMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVDDSESLKCEELHLHAENLSRRVWELLM
LLPTCPNMLTAFQSISDEQSNDGVNWKELLKIKSAHKLLYALEIIEALGKPNRRIRREST
GSYSDLYPDSDDSSEDQVENSKNSWTCKFVAAGGLQQLLEIFNSAMLEPKEHESWTVWQL
DCLACLLKLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRAWPGKSRKAAGDHAKSLHVP
RLTEVFLVLVQGTSLIQRLMSVAYTYDHLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHC
CSLVKSSLADSDHLQDWLRKLTLLIPETAVRHESCNGLYKLSLSGLDGGDSIHRSFLLLA
ASTLLKFLPDAQALKPLRIDDYEEEPMLKPGCKEYFWLLCKLVDNIHIKDASQTTLLDLD
ALARHLADCIRSREILDHLDGNLEDDGLSGLLRLATSVIKHKPPFKFSREGQEFLRDVFN
LLFLLPSLKDRRQPKCKSHSSRAAAYDLLVEMVKGSVENYRLVHNWVMAQHMQSHAPYKW
DYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLE
LQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKVEEMSPELKN
TVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNM
YTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYT
EDFLMGKSDRKEGFKDVGDHSKDTESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYK
NNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRM
EPEEENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKA
VSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQ
ILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDASVEDIGGRSCVTR
FVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGP
ENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQT
DMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEA
ANPFFKLLTMLMEFAGGPPGTPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSW
VLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPD
TTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYLSFMTYCLISKTEKLMFSTYFMDL
WNLFQPKLSEPAIATNHNKQALLSFWYNVCTECPENIRLIVQNPVVTKNIAFNYILADHD
DQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEEL
FNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDR
LLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLAELLSIFLSVLKSTRPYLQRKDVKQ
ALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCT
YHHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDGYDRTLL
DFFFSYHQLIHLVCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAM
SRNCVKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCASLIS
TLITNLINQYQNLQSDFTNRVEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQEL
LNKCRTCLQQRNSLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSCIGDIKTDARDV
LTPTSTSDNETRDSSIIDPGTEQDLPSPENGSVKEYRMEGPSSFSEDGSHTRSQHAEEQS
NSGRFDSCKDHSSKDATLADDESEFPSTSISAVLSDLADLRSCDGQALSSQDPEAAVSLS
CGHSRGLISHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
NT seq 10752 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaactgcgcagacctggtggaggtgttaaatgaaatatcagacctagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttgcttatatcaattcc
tggactcagaggcaatgtctatgctgcttcaaggaatataagcatttggagatttttaac
caagtagtatgtgcacttattaacttagtgattgcccaagttcaagtgctccgggaccag
ctttgtaaacattgtactaccactaacacagattccacgtggcaagatgagagtaatgaa
gcggaagaaccactgagtatagatagagaatgtaatgaaggacatacagaaagacagaaa
tcaatagaaaaaaaatcaaactctacaggaatttgtaatctgactgaggaggaatcttca
aagagttctgatccttttagtttatggaatacagatgagaaggaaaaactattactatgt
gtagcaaaaatttttcaaattcagtttcccttatatactgcttacaagcataatactcat
cctactattgaggatatatcgacacaagaaagtaacatattaggggcattctgtgatatg
aatgatgtagaagtacccttgcatttgcttcgttatgtctgtctgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatgggactcctgaaactttaccatttctt
atagcacatgcatttattacagttgtttctaatattaggatatggctacatatccctgct
gtcatgcagcacattattccttttagaacgtatgttatcaggtatttatgcaagctctct
gatcaggagttacgacagagtgcggctcgaaatatggctgaccttatgtggagtacagtg
aaagagccattggatacaacactgtgctttgataaggaaagtctagaccttgcatttaag
tactttatgtcaccaactctgaccatgaggttggctggattgagtcagataacaaatcag
cttcacactttcaatgatgtgtgcaataacgaatcattggtatcagacacagaaacgtcc
attgcaaaagaacttgcagactggcttattagcaacagtgtaatagagcacatatttgga
ccaaatcttcacattgagattatcaagcagtgccaagtgattttgaatttcttggcggca
gagggacgactcagtactcagcatatcgactgcatttgggccgcagcacagctgaaacac
tgtagtcggtatattcatgacttattcccttcactcatcaagaacctggatcctgtgcca
cttagacatttactcaatctggtctcagctcttgagccgagcgttcatactgagcagaca
ctgtacttggcatccatgttaattaaagctttgtggaataatgcacttgcagctaaggct
cagctatcgaagcagagttcttttgcatctttgttaaacactaatatgcccattggaaat
aagaaagaggaagaagagcttagaagagcagctccttcaccttggtcccctgcagcgagt
cctcaaagtagtgataacagtgacacccatcagagtggagccagtgacattgaaatggac
gagcagctcatcaatagaaacaagcatgtgcagcagcgcctgtcggacacagaggaatcc
atgcaagggagctctgatgaaaccgccaacagtggcgaggacggaagcagtgggcctggt
agcagtagtgggcagagtgacgggtcgagccatgaagtcaactcgagccatgcaagccag
tctgcggggagccctgggagtgagctgcaatccgaagacatcgcagacattgaggccctt
aaagaagaggaagaggaggaggaggaggaggaagaggaggaagaagaagaggaagaagat
gaagaagaagaagaagatgatgaagaagaagatgatgatgatgacgatgacgatcatgct
cacaatcctcccaaaaatacttgtggaacagaaatgcggaacagaaagttagaaaaccaa
gcagccatctgcttgggggaatcccaagccacatctgaaaggaatgggacacatggcgga
gcaggaaaggacctggtgtttaacactgagcccttgccgtccgtggataaccgaatacga
atgctagatgcctgtgctcactctgaagacccagaacatgatatttcaggggaaatgagt
tctgctcacatagcacaaggttctcaggagtcttgcatcacccgaagtggggacttcctt
ggggagactattgggaatgagttgtttaattgtcggcagttcattggtccacagcaccac
caccaccaccaccaccaccaccaccatcaccaccaccaccaccaccaccaccaccaccac
cacgatggacatatggttgacgatatgctaagtgcagatgatgtcagctgcagtagctcg
caggtcagtgcaaaatcagaaaaaaacatggctgattttgatggtgaagaatctggatgt
gaagaggaactagttcagataaattcacatgcagaactaacatctcatcttcaacaacat
cttcccaatttagcatcgatttaccatgagcatcttagtcaaggccctgcagttcataaa
catcaatttagtagcaatgctgtgacagatattaatttggataatgtttgcaagaaagga
aatactttattgtgggatatagtgcaagatgatgatgcgattaatctttctgaaggatta
ataaatgaggcagagaaacttctctgttctttggtttgttggtttacggatagacagatt
cgaatgagattcattgaaggctgccttgaaaatttagggaacaacagatcagtagtgatt
tcacttcgtctcctcccgaagctgtttggtactttccagcagtttggtagcagttatgac
acgcattggatcacaatgtgggcagagaaagaactgaacatgatgaagcttttctttgac
aatctggtgtattacattcagggcataagggaaggcagacaaaagcacacactgtacagc
catagtgcggaagttcaggtccgacttcagttcctgacctgtgtgttctcaaccctggga
tcgcctgaccacttcaggttaagtttagagcaagtcgacattttatggcattgtttagtg
gaagattctgagtgctatgatgatgcacttcattggtttttaaatcaagttcgaagtaaa
gatcaacacgcaatgggaatggagacctacaaacatcttttcctggagaagatgccccag
ctgaaacctgaaacaattagcatgactggcttaaacctgtttcagcatctctgtaacttg
gctcggttggctaccagtgcctatgatggtggctctaactctgagctgtgtggtatggac
caattttggggcatcgccttaagagcacaatccggtgatgttagtcgagcagctattcag
tatattaactcctactatattaatggtaaaacgggtttggaaaaggaacaagaatttatt
agtaagtgcatggaaagtcttatgatagcgtctagcagtcttgaacaagaatcacactca
agcctcacagttatagaaagaggattgcttatgctgaagacacatctggaagcatttagg
agaaggtttgcatatcatctgagacagtggcaaattgagggcactggtattagtagtcac
ttgaaagcactgagtgacaaacagtctttgcctctgagggttgtatgtcagcctgctgga
cttcctgacaagatgactattgagatgtaccccagtgaccaggtagcagatctcagggct
gaagtaactcattggtatgaaaacttacagaaagaacagataaatcaacaagctcagctg
caggagtttggtcaaagcagcagaaagggagaattccctggtggcctcatggggcctgtc
aggatgatctcttctggacatgagttgacaacagactacgatgaaaaagcacttcatgaa
cttggttttaaagatatgcagatggtatttgtatctttgggtgccccaagaagagaaaga
aaaggagaaggtgttcaactgcctgcatcttgcctcccaccacctcaaaaggacaacatt
cccatgcttttgctgttacaggaacctcatttaactactctctttgatttattagaaatg
cttgcttcatttaaaccaccctcaggaaaagtggcagttgatgacagtgagagtttaaag
tgtgaagaacttcatcttcatgcagagaatctttcacggcgtgtgtgggagttgctcatg
cttcttcctacttgtccaaacatgctgacggcgttccagagtatctcggatgagcagagt
aatgatggagttaattggaaggaacttctcaagattaagagtgctcataagttgttatac
gctcttgaaattattgaagcactcggaaagcctaacagaagaataagaagagagtcaacg
ggaagttacagtgatctttatccagattctgatgattcaagtgaagatcaagtggaaaat
agtaaaaattcctggacttgcaagtttgttgctgctggcggtcttcagcagttactagag
attttcaactctgcgatgctggaacctaaagagcatgagtcatggactgtgtggcagcta
gattgtcttgcttgcttgctgaagttaatctgccagtttgcagtagacccatcagacttg
gatttagcttatcatgatgtttttgcctggtctggcatagccgaaagccataggaaaaga
gcctggcctggcaaatcaagaaaggctgctggtgaccacgccaagagtctccatgttcca
cgcctaacagaggtgtttcttgtgctcgtccaaggaaccagtttgattcagcgacttatg
tctgttgcttatacgtatgatcatctggctcctagggttttgaaagctcagtctgatcac
aggtctaggcatgaagtgtcccattattcaatgtggctcttggtgagctgggcgcattgc
tgctctttagtgaagtccagccttgcggacagtgatcatttacaagactggctaagaaaa
ctgaccctcctcattcctgagactgcagttcgccacgaatcttgcaatggtctctataag
ctatctctgtcaggcctagatggaggagactcaatccatcgatctttccttcttttggct
gcctcaacattgttgaaattccttcctgatgctcaagcactcaaacctctaaggatagat
gattatgaagaagaaccaatgttaaaacctggatgtaaagaatatttttggttgttatgc
aaattagtggacaacatacatataaaggacgctagtcagacaacactcctcgatttagat
gctttggcaagacatttggctgactgtattcgaagtagagagatccttgatcacctggat
ggtaatctcgaagacgatgggctttcagggcttctgaggcttgcaaccagtgttattaag
cacaaaccacccttcaaattttcaagagaaggacaggaatttttaagagatgtcttcaat
ctcctgtttttgctgcccagtctaaaggaccggcggcagccaaagtgcaagtcccattct
tctcgagctgcggcctacgacctgttggtagagatggtcaaagggtctgtggagaactac
aggctagtccacaactgggtcatggcccagcatatgcagtcccatgcaccttataagtgg
gactactggcctcatgaggacgtgcgtgcagaatgccggtttgtcggcctgactaacctt
ggagcgacttgctacttggcttccaccattcagcagctttatatgataccagaggcgagg
caggctgtcttcactgctaagtattcagaagatatgaagcacaagactactcttctggaa
ctccagaaaatgtttacatatttaatggagagtgagtgcaaagcatacaaccctaggcct
ttctgtaagacgtacacgatggataagcagcctctgaacaccggggagcagaaggatatg
acagagtttttcacagacctcattaccaaagtggaagaaatgtctccagaactgaaaaat
actgtcaaaagcctgtttggaggtgtcataacaaacaatgttgtttctttggattgtgaa
catgtcagtcaaactgctgaagagttttataccgtgaggtgccaggtggcagacatgaag
aatatctacgaatctcttgatgaagtcactattaaagataccttagaaggggacaacatg
tacacttgttctcattgtgggaagaaagtccgagcggagaaaagggcttgtttcaagaaa
ttacctcgtattctgagtttcaatactatgagatatacatttaatatggtcacgatgatg
aaagagaaagtgaatacgcacttttccttccccttacgcttggacatgacaccctataca
gaagatttcctcatggggaagagtgataggaaagaaggttttaaagacgttggtgatcat
tcaaaagacacagagagctatgagtatgacttgatcggagtgactgtgcacacaggaaca
gcagatggtgggcactattacagcttcatcagagacatagtcaatcctcatgcttataag
aacaataaatggtacctttttaacgatgctgaggtaaagccttttgattctgctcagctt
gcctctgaatgctttggtggcgagatgacgacaaaaacctatgattcggttacagataaa
ttcatggatttctcctttgaaaagacacatagtgcatacatgctgttttacaaacgcatg
gaaccagaagaagaaaatggcagagaatacaaatttgacgtttcatcagagttactagag
tggatttggcatgataacatgcaatttttacaagacaaaaacattttcgaacacacttat
tttgggtttatgtggcagctgtgtagttgtattcctagcacattaccagaccctaaagct
gtgtcgctgatgacagcgaagctaagcacttcctttgttttagagacattcattcattca
aaagaaaagccaacaatgcttcagtggattgagctgctgaccaaacagtttaacaacagt
caagcagcctgtgagtggtttttagaccgcatggctgatgatgactggtggccaatgcag
atactaattaagtgtcccaatcaaattgtgagacagatgttccagcgcttatgcatccat
gtgatccagaggctgagacccgtgcatgcgcatctctatctacagccagggatggaggac
gggtctgatgatatggatgcctcagtagaagacattggaggtcgctcatgtgtcactcga
tttgtcagaactctgttgctaattatggagcacggtgtgaaacctcacagcaaacatctc
accgagtatttcgctttcctttatgagtttgccaaaatgggtgaagaagagagccagttt
ctactttcattgcaagccatatctacaatggtccatttctatatgggaaccaaaggacct
gaaaatcctcaagttgaagtcttgtcagaggaagaaggggaagaagaggaggaagaagaa
gacatcctctctctggcagaagaaaagtacagacccgctgcccttgaaaagatgatagct
ttagttgctcttttggttgaacagtctcgctcagaaaggcatttgacattgtcacagact
gacatggctgcactaacaggaggaaagggatttcccttcttatttcaacatatccgtgac
ggcatcaatataagacaaacttgtaatctcatttttagcctgtgtcggtacaacaatcga
cttgcagaacatattgtatctatgcttttcacttcaatagcaaagttgacacctgaggca
gccaatcctttctttaaactgctgaccatgctgatggagtttgctggtgggcccccagga
acgcccccctttgcatcttacattctgcagaggatttgggaggttattgaatacaatcct
tctcagtgtctggactggttggcagtgcagacaccccggaataagctggcacacagctgg
gtgctccagaatatggaaaactgggtcgagcggtttcttttggctcacaattatcctaga
gtcaggacttctgcagcttatcttctggtgtcccttataccaagcaattcattccgccag
atgttccggtcaacaaggtctttgcacatcccaacccgtgaccttccactcagtcctgac
acaacagtagtcctgcatcaggtctacaacgtgctccttggtttgctctcaagagccaaa
ctttatgttgatgctgctgttcacggcactacaaagctagtgccctatcttagctttatg
acttactgtttaatttccaaaactgagaagctgatgttttccacatatttcatggatttg
tggaaccttttccagcctaaactgtctgagccagcaatagctacaaatcacaataagcag
gctttgctttcgttctggtacaatgtgtgtactgagtgtccagagaatatccgccttatt
gttcagaacccagtggtaaccaagaacattgccttcaattacatccttgctgaccatgac
gaccaggatgtggtgctttttaaccgtgggatgctgcctgcctactatggcattctgcgg
ctctgctgtgagcagtcacctgcatttactagacagctagcttctcatcagaacatccag
tgggcctttaagaacctcacaccgcacgccagccagtaccctggagctgtggaagaactg
tttaatttgatgcagctgtttatagcgcagagaccagacatgcgagaagaagagttagaa
gatattaaacagtttaagaaaacaaccataagctgttacttgcgctgcttagatggccgc
tcttgttggaccactttaataagtgccttcagaatactcttagaatctgatgaagacaga
cttcttgtagtgtttaatcgagggttaatcctgatgactgagtccttcaacacactgcac
atgatgtaccacgaagcaacagcctgccacgtgactggagacttagcagagcttctgtca
atattcctttcggttttgaagtctacacgcccatatctccagagaaaagatgtgaagcag
gcactaatccagtggcaggagagaattgaattcgcccataaacttctaacccttcttaat
tcctacagccctccagaattacgaaatgcttgcattgatgtcctcaaggaacttgtcctt
ttgagcccccatgattttctgcatactctggttcccttcctacagcacaaccattgtact
taccatcacagtaatataccaatgtctcttggaccttatttcccttgtcgagaaaatatc
aagctaataggagggaaaagcaatattcggcctccgcgccctgaactcaatatgtgcctc
ttgcccacaatggtggaaaccagtaagggcaaagatgacggttatgatcgtacgctgcta
gacttcttcttttcttaccatcagctcatccacctagtatgccgagttgcaatcaactgt
gaaaaatttactgagacgttagttaagctgagtgtcctggttgcctacgaaggcttgcca
cttcaccttgcactgttccccaaactttggactgagctgtgccagactcagtcagctatg
tcaagaaactgcgtcaagcttctgtgtgaggatcctgtttttgcagagtacattaaatgt
atcctaatggatgaaagaacttttctaaacaacaatattgtctacacgttcatgacacat
ttccttctaaaggttcaaagtcaagtattttcagaagcaaactgtgccagtttgatcagt
acccttattacaaacctgataaatcagtatcaaaacctacaatctgatttcaccaaccga
gttgaaatttcaaaagcaagtgcttctttaaatggggacctgagggcacttgctttgctc
ctgtcagtacacactcccaaacagttaaacccagctctgattccaactctgcaagagctt
ttaaacaagtgcaggacttgtctgcagcagagaaactcactccaagagcaagaagccaaa
gaaaggaaaacgaaagatgatgaaggggcaacccctgttaagaggcggcgagtgagcagt
gatgaggagcacactgtagacagctgcattggagacataaagacagatgccagggacgtc
ctgacccccactagcacctcagacaatgagacaagagactcatcgattattgatccaggg
acagagcaagatctgccatcccctgaaaatggctctgtcaaagagtatcggatggaaggc
ccatcttcgttttcggaagacgggtcacatacccggtcacagcatgcagaggaacagtct
aacagtggcaggttcgacagctgtaaagaccatagttccaaggatgctacactagccgac
gatgaatcagagttcccttccacgtccatctctgcagttctgtctgacttagctgatctg
agaagctgtgatggtcaagctttgtcctcccaggaccctgaagctgctgtatcactcagt
tgtggccattccagaggcctcattagtcacatgcagcagcacgacattttagataccctg
tgtaggaccattgaatcaacaatccatgtggtcacaaggatatctggcaaaggaaaccaa
gctgcttcttga

DBGET integrated database retrieval system