KEGG   Rattus norvegicus (rat): 361190Help
Entry
361190            CDS       T01003                                 

Gene name
Usp19
Definition
ubiquitin specific peptidase 19 (EC:3.4.19.12)
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     361190 (Usp19)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   361190 (Usp19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8
AA seq 1357 aa AA seqDB search
MSAGTSATGPRRGPPGLEEATSKKKQKDRANQESKDGDPRRVSMPRKEPTKDELLLDWRQ
SSDKVVVKLRVGTGPICLEEVDAAFTDTDCVVRLPDGRQWGGVFFAKIQSSCTKVQTRKG
GLLQLALPKKVPLLTWPSLLKKPLGTQELVPGLRCQENGQELSPIALEPGSEPRRAKQEA
RNQKRAQGRGEVGSGASPGAQAGPSAKRAVHLCRGPEGEGSMDGPGPQGDAPSFLSDSAT
QVEAEEQLHVPPVNPQTSLLGSEKNLALLTVEKTVSPRSDSVSPVMIRNRDPEKDDHFKE
EMAVGADPAALADEPESMVNLAFVKNDSYEKGPDSVVVHVYVKESRRDTSRVLFREQDFT
LIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWG
GLEAPATRVGGAKVAVPTGPTPLDSTPPGGGPLPLTGQEEARAVEKEKPKARSEDSGLDG
VVARTPLEHVTPKPEPHLASPKPTCMVPPMPHSPVSGDSVEEDEEEEKKVCLPGFTGLVN
LGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLRALWKGT
HQAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGR
PDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQK
VLPIYYFAREPHSKPIKFLVSVSKENSSASEVLESLSQSVHVKPESLRLAEVIKNRFHRV
FLPSHSLDAVSPTDVLLCFELLSPELAKERVVVLEVQQRPQVPSIPISKCAACQRKQQSE
DEKLKRCTRCYRVGYCNQFCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYARLAQLLE
GYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTSSLEAGDSEREPIQPSELQLVTPVAE
GDTGAHRMWPPADRGPVPSTSGISSEMLASGPMEGCSLLAGERVSRPEAAVPGYQHSRES
VSAHTPQFFIYKIDASSREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLVASKELE
CAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPN
VLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGM
IGGHYTACARLPSDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRNSPVERP
PRAAHAEHHPDLGPAAEAAASQASRIWQELEAEEEMVPEGPGPLGPWGPQDWVGPPPRGP
TTSDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggcaccagtgctacaggcccaaggagggggcctccgggattggaggaggca
actagtaagaagaaacagaaggatcgagcaaaccaggaaagtaaggatggagatcctagg
agagtgtccatgcctcgaaaggagcccaccaaagatgaactgttgctcgattggagacag
agttcagataaggtggttgttaagctgcgcgtgggaacaggtcccatatgtctggaggaa
gtagatgctgctttcacagacacggactgtgtggtgaggcttccagatggtcggcagtgg
ggtggtgtcttctttgctaaaatacaaagttcttgtaccaaagtgcagactcgcaagggt
ggtcttctacagttggcactaccaaagaaggtgcctcttctcacgtggccctctctcctg
aagaaacctctagggacccaagaactggtgccaggattgcggtgccaggagaacggacaa
gaactgtctcccattgccctggagccaggttctgagccccgcagagctaaacaggaagct
cgaaaccagaagagggcccagggccgtggtgaggtaggctcaggggctagccctggggca
caggcagggcccagtgccaagagggctgttcatctctgcagagggccagaaggtgaaggg
tccatggatgggcctggcccccagggtgatgccccatccttcctgtccgactcagctacg
caggttgaggctgaggagcagctccatgttccaccagtgaaccctcaaacaagtctcttg
ggctcagagaagaatttagcccttttgacagtagagaagacagtgtcccccaggagtgac
tcagtctccccagtcatgatccggaacagagaccctgagaaagatgaccatttcaaagag
gagatggcagttggagctgatcctgcagccttagcggatgaaccagagtctatggtgaac
ctggcatttgtcaagaatgattcgtatgagaaggggccggattcagtggtggtgcacgtg
tatgtgaaggagagccgcagggatacctctcgagtacttttccgagagcaggacttcacg
ctgatcttccagaccagggatggaaattttctgaggctgcatccgggctgtgggccccac
accatcttccgctggcaggtgaagctcaggaacttgattgagccagagcaatgtacgttt
tgtttcacggcctctcgaatcgatatctgcctccggaagcggcagagtcagcgctggggg
ggactggaggcccctgctacacgagtgggtggtgcaaaggttgccgtgccgacaggtcca
acccctttggattcaacccctccaggaggtggccccctccctctgactggccaggaggaa
gccagggctgtagagaaggaaaaacccaaggctcggtcagaggactcggggctggatggt
gtggtggctcgcacccccttggagcatgttaccccaaagccagaaccgcacttggcctcg
cccaaacccacatgtatggtgcctccaatgcctcatagtccagtgagtggagatagtgtg
gaggaggatgaagaggaagagaagaaggtttgtctcccaggctttactggcctcgtcaac
ttagggaacacctgcttcatgaatagtgtcattcagtctctgtccaacactcgggagctt
cgtgacttcttccacgaccgatcctttgaggctgagattaactacaataacccattgggg
actggtgggcgtctggctattggcttcgctgtgctgctccgggccctgtggaagggcact
caccaagcctttcaaccctccaagctaaaggccattgtagcaagcaaggccagccagttt
acaggctacgcacagcatgatgcccaagagttcatggctttcttgttggatgggctgcat
gaagacctgaatcggatccaaaacaaaccctacacagagactgtggactcagatgggcga
cctgacgaggtggtggctgaagaagcatggcagcggcacaagatgaggaacgactcattc
attgtggacctgtttcagggccagtacaagtcaaagctggtgtgccctgtgtgtgccaag
gtctccatcacttttgacccgttcctttatctgccggtacccttgccacaaaagcaaaag
gttctccccatatattattttgccagagagccccatagcaaacccatcaagttcctggtg
agcgtcagcaaggagaactccagcgcaagcgaagttttggagtccctctctcagagtgtc
cacgtgaagcctgagagcctgcgcctggctgaggtaattaagaatcgtttccaccgtgtt
tttttgccctcccactcactggatgctgtgtcgccaacggacgtgctcctgtgctttgag
ctgctatccccagaattggctaaggagagggtagtggtgctagaggtgcagcagcgcccc
caggtacccagcatccctatctccaagtgtgcagcctgccagcggaagcagcaatcagaa
gatgaaaaactgaagcgttgtacccgttgctaccgtgtgggctactgcaaccagttctgt
cagaaaacccattggcctgaccacaaaggcctctgccgccccgagaacattggctacccc
ttcctggtcagtgtacctgcttcacgcctcacttatgcccgtcttgctcagctactagaa
ggttatgcccggtactctgtgagcgtattccaaccacccttccagcctggccgaatggct
ttggaatcacagagccctggctgtaccacgttgctttcaaccagctctctggaggctggg
gatagtgaaagagaacccattcagccttctgagctccagttggtgactcctgtggctgag
ggggataccggggctcaccgcatgtggccacctgctgatcggggtcctgtgcctagcacc
agtggaatttcttccgagatgctggccagtgggcctatggaagggtgttccttgcttgct
ggtgagagggtgtctcggcctgaagctgctgtgcctgggtaccagcactcacgtgagtct
gtgagcgcccacacgccccagttcttcatctataaaattgatgcgtcaagccgtgagcag
cggctggaggacaaaggggacactccactggagctaggtgatgactgtagcctggctctg
gtgtggcggaacaacgaacgccttcaggagtttgtgctggtggcctccaaggagctggag
tgtgctgaagacccaggctccgctggtgaggctgcccgtgctggccacttcaccctggac
cagtgcctcaatctctttacacggcctgaagtgctggcacctgaggaagcctggtactgc
ccacagtgcaaacagcatcgagaggcctccaagcagctgctgctgtggcgcctaccaaat
gtgctcatcgtgcagctcaagcgtttctcctttcgtagcttcatttggcgtgacaagatc
aatgacttggtggagtttccagttcggaacctggacttgagcaagttctgtattggtcag
aaagaggagcagctgcctagctatgacctgtatgcagtcatcaaccactacggaggcatg
atcggcggccactacactgcctgtgcacggctgcccagtgaccgtagtagccagcgcagt
gacgtgggctggcgcttgtttgatgacagcacggtgacaacagtagacgagagccaggtg
gtgacacgctatgcctatgtgctcttctaccgtcggcggaactctcctgtggagaggccc
cccagggcagctcacgctgaacaccacccagacctaggccctgcagccgaggctgctgcc
agccaggcttcccggatttggcaggagctcgaggccgaggaggagatggtgcccgagggg
cctgggcctctgggtccttgggggccccaagactgggtggggcccccgccacgtggccct
accacatcagacgagggctgcctccgatactttgtcctgggtaccgtggcggctttggtg
gcccttgtgctcaacgtattctatcctctggtatctcagagtcgctggagatga

DBGET integrated database retrieval system