KEGG   Rattus norvegicus (rat): 361401Help
Entry
361401            CDS       T01003                                 

Gene name
Pla2g15, 1-O-acylceramidesynthase, ACS, LLPL, LPLA2, Lypla3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    361401 (Pla2g15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    361401 (Pla2g15)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     361401 (Pla2g15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q12
AA seq 413 aa AA seqDB search
MDRHLCICREIQLRSGLLFPFLLLMMLADLALPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGE
TFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEM
IEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQ
DIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccatctctgcatttgtcgcgagatccagctccggagtggcctcctgttccct
tttcttctactaatgatgctggcagacctagcgctcccggcccaacgtcaccccccggtg
gtgctggtgcctggtgatttgggtaaccagttggaagcaaagctggataagccaaaggtt
gtacactacctgtgctccaagaggacggacagttacttcacactctggctgaatcttgaa
ctgctcctgccagttatcattgactgctggattgacaatatcaggctggtttacaacaga
acatctcggactacccagtttcctgatggtgtagatgtgcgtgttcctggctttggggaa
acattttctctggaattcctagacccaagcaaaaggaacgtgggttcctatttctacact
atggtggagagtcttgtgggctggggctacacacggggggaagatgtccgtggtgctccc
tatgattggcgcagagccccaaatgaaaacgggccttacttcttggccctccaagagatg
atcgaggagatgtaccagatgtatgggggccccgtggtgctggtcgcccacagcatgggc
aacatgtacatgctctactttctgcagcggcaaccacaggcctggaaggacaagtatatc
caagccttcgtctcactgggtgcgccctgggggggcgtggccaagaccctgcgtgtcctg
gcctcaggagacaacaaccgtatccctgtcattgggccactgaagatccgggaacagcag
cgatctgcagtctccaccagctggctactgccgtacaaccacacgtggtcacatgaaaag
gtgtttgtgtacacacccacagctaactacacactccgggactatcaccggttcttccaa
gacatcggctttgaagacggctggttcatgaggcaggacacacaagggctggtggaagcc
ctggtaccgcctggtgtagagctgcactgcctgtacgggaccggtgttcccacaccaaac
tctttctactacgagaactttcctgatcgtgacccaaaaatctgctttggggatggtgac
ggcacagtgaacttggagagtgtcctgcagtgccaagcctggcagagccgccaagagcac
aaagtgtcattgcaggagctgccagggagcgaacacattgagatgctggccaatgccact
accttggcttatctgaaacgtgtgcttctagaagaaccttga

DBGET integrated database retrieval system