KEGG   Rattus norvegicus (rat): 361401Help
Entry
361401            CDS       T01003                                 

Gene name
Pla2g15, 1-O-acylceramidesynthase, ACS, LLPL, LPLA2, Lypla3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rno00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:rno04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q12
AA seq 413 aa AA seqDB search
MDRHLCICREIQLRSGLLFPFLLLMMLADLALPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGE
TFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEM
IEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQ
DIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccatctctgcatttgtcgcgagatccagctccggagtggcctcctgttccct
tttcttctactaatgatgctggcagacctagcgctcccggcccaacgtcaccccccggtg
gtgctggtgcctggtgatttgggtaaccagttggaagcaaagctggataagccaaaggtt
gtacactacctgtgctccaagaggacggacagttacttcacactctggctgaatcttgaa
ctgctcctgccagttatcattgactgctggattgacaatatcaggctggtttacaacaga
acatctcggactacccagtttcctgatggtgtagatgtgcgtgttcctggctttggggaa
acattttctctggaattcctagacccaagcaaaaggaacgtgggttcctatttctacact
atggtggagagtcttgtgggctggggctacacacggggggaagatgtccgtggtgctccc
tatgattggcgcagagccccaaatgaaaacgggccttacttcttggccctccaagagatg
atcgaggagatgtaccagatgtatgggggccccgtggtgctggtcgcccacagcatgggc
aacatgtacatgctctactttctgcagcggcaaccacaggcctggaaggacaagtatatc
caagccttcgtctcactgggtgcgccctgggggggcgtggccaagaccctgcgtgtcctg
gcctcaggagacaacaaccgtatccctgtcattgggccactgaagatccgggaacagcag
cgatctgcagtctccaccagctggctactgccgtacaaccacacgtggtcacatgaaaag
gtgtttgtgtacacacccacagctaactacacactccgggactatcaccggttcttccaa
gacatcggctttgaagacggctggttcatgaggcaggacacacaagggctggtggaagcc
ctggtaccgcctggtgtagagctgcactgcctgtacgggaccggtgttcccacaccaaac
tctttctactacgagaactttcctgatcgtgacccaaaaatctgctttggggatggtgac
ggcacagtgaacttggagagtgtcctgcagtgccaagcctggcagagccgccaagagcac
aaagtgtcattgcaggagctgccagggagcgaacacattgagatgctggccaatgccact
accttggcttatctgaaacgtgtgcttctagaagaaccttga

DBGET integrated database retrieval system