KEGG   Rattus norvegicus (rat): 361495Help
Entry
361495            CDS       T01003                                 

Gene name
Usp29
Definition
ubiquitin specific peptidase 29 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q12
AA seq 872 aa AA seqDB search
MAHLKIHGLVQIRSTNRSKHTRASQWKEAVIEIVERKQKVNLVVSFKLEERRRVFQLGDN
VTGVVVSGELGLYHLDLTLRDDTSLLIDKLSSADVEHLKSFLDSSTPCESQQPMESMSNQ
DTLEISDPFFRENQDVVCVSLNTALESGTLLSRKMPLCMSNTTGSHTEKKRGEKQGRKRK
TEPSPSTVEVTTKDILKENNPEQKKKSRRYYSRNRGGKAEKAVALREQEKRNNWKLEPAF
SSKVYGKSTLDGTVLPIATCSDDRDLSIFGLEIITHNGIQPPPDNYLKQLKREGFPNLGN
TCYMNSILQSVFGIPTFAKDLLTQGIPWEKVSYDDLIMPLSQLLVLKDIRDIEIKGELLT
SVKKSISTVADTFSGNEQNDAHEFLSLCLDQLKLNMEKVNAMWDTERKNEPTCAGAKRFV
CPVGANFEFELHSSIICEGCGEATLKTEVSNYLSIDLHHGTKTHPLSIQKSFDLFFTPEK
IEHNCEKCKNKNSVLKYTLRRLPRVLIVHLKRYQVTTDLLPVKSEQPVEISQYLNISSHC
HENRKLPFPLINTPPKGDYDIPNVSPGLMPEIFSQSMSSKKVISESSDPLVLQVGSSVDA
EIQSFQIMYEDESEEEQQRGLESGSMLDPELLKTENRVFRQKISPAPDSMMGDGYSFLPM
LCEPMSIQDPGLAEMGLQEVPENPEFKYYGKPDGRTNSELSKLHQNHGGRIKGSYLPASF
ANMRSSLEDPEKDLSRSSEFEEDDPHSFALGSDESKDEEMGDNLHNYRLVSVVSHFGSSP
NSGHYVSDVYDFQRQAWLLYSDVQVFENPDPSSQENRLHTGYIFFYMHNEIFEELLKKAS
ECKVLSTSKEEKRDIDYFSTLLNGLTYILEEF
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctaaagatacatggtttggtccagatccgcagcacaaacaggagcaagcac
accagggcatctcagtggaaagaagcagtcatcgaaatagtagaaagaaaacagaaagtt
aatctggtggtttcttttaagttggaggagaggagaagggtttttcagctgggtgataac
gttacaggtgtagtggttagtggcgagctgggactgtatcatctggatttaactttgaga
gatgacacgtccttactcattgacaagttatcctccgcagatgttgagcatttgaagtca
ttcctggattcgtccactccatgtgaatcccagcaacccatggagtccatgagtaatcag
gatactcttgaaatcagcgacccatttttcagggagaaccaagacgtagtctgtgtttcc
ctgaatactgccctagagagtgggacactgctctcccggaagatgccactctgtatgtca
aacaccacgggcagtcatactgaaaaaaagagaggagaaaaacaaggcagaaaaaggaag
acagaaccatcaccatccactgtagaagtgaccaccaaggatattctcaaagaaaataat
cctgaacaaaaaaagaaatccaggcggtattactccaggaatagaggaggcaaagccgag
aaagctgtggctttaagggaacaagaaaagcgcaacaattggaagcttgaacctgctttc
agttccaaagtctatggaaagtctaccctagacggcactgttctcccaatcgcgacgtgc
tctgatgacagagatttatcgatatttggcctggagatcataacacataacggaatccag
cctcctccagacaattacctgaagcagctaaagcgtgaaggcttccccaatttgggaaat
acttgctacatgaattccatcttacaatctgtctttggaattccaacctttgcaaaggac
ttactcactcaaggtatcccatgggagaaagtttcctacgatgaccttatcatgccctta
agccagcttcttgtcttgaaagacattcgagatatagagatcaagggcgagttactcacc
agtgtgaagaagtccatctccacagttgcagacacattctcgggcaacgaacagaatgat
gcccatgagtttttaagtctgtgtttagaccagctgaaactgaacatggaaaaagtaaat
gccatgtgggacactgagaggaaaaatgaaccaacgtgtgctggagccaaaaggtttgtt
tgtcccgttggtgctaattttgaatttgagctgcatagctccatcatctgtgaaggctgt
ggggaggctactctcaagaccgaagtgagcaattacctctccatcgacctgcaccacggg
acaaaaacacaccctctctcaattcaaaagtcttttgatctgttcttcacaccagaaaaa
attgagcataactgcgagaaatgcaagaacaagaattctgttctcaagtacacattgagg
agactccccagggtcctcattgttcatctgaaacgctaccaagttaccactgacttgttg
ccagtgaagagtgagcagccagttgagatttctcagtatttgaatatatcttcccattgc
catgaaaacaggaagttaccatttcccttgatcaatacaccccctaagggagactatgat
atcccaaatgtctctccagggctgatgcctgagatctttagccagtcaatgtcgtctaag
aaggtgatttctgaatccagtgaccccctggttctacaggttggatccagcgtggatgcc
gaaatacaaagcttccagataatgtatgaggatgaaagtgaagaagagcagcagagaggc
ctggaaagtggttctatgctggacccagaactattgaagacagaaaacagggtattcaga
cagaagatatctccagcacctgactcaatgatgggtgacggatacagcttccttcctatg
ctctgtgagcctatgagcatccaagacccaggtcttgcagagatgggtcttcaagaggtt
ccagagaatccagaatttaagtactatggaaagccagatggccgtactaacagtgagctg
tcaaaactccaccagaatcatgggggtcgaatcaagggttcgtatctaccggcatcattt
gcaaatatgagaagttctctggaagacccagagaaggacctgagcaggtcttcagaattt
gaggaagatgatccgcattcctttgcattgggttctgatgaatcaaaggatgaggagatg
ggagacaatcttcataattacaggctcgtcagtgttgtcagccattttgggagctcccca
aattcaggccattacgtaagtgatgtgtatgacttccaaaggcaagcctggctcctttac
agtgatgtccaagtgttcgagaatccagatccctccagtcaggagaataggcttcacact
ggatacattttcttttacatgcataatgagatttttgaggaactgttgaaaaaagcatcg
gagtgcaaggtccttagcacatctaaagaagaaaagagggacatagattatttctcaaca
ctgcttaatggccttacatatatcctagaagagttctaa

DBGET integrated database retrieval system