KEGG   Rattus norvegicus (rat): 361523Help
Entry
361523            CDS       T01003                                 

Gene name
Cyp2b2, CYPIIB2, Cype
Definition
(RefSeq) cytochrome P450, family 2, subfamily b, polypeptide 2
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    361523 (Cyp2b2)
   00590 Arachidonic acid metabolism
    361523 (Cyp2b2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    361523 (Cyp2b2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    361523 (Cyp2b2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     361523 (Cyp2b2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   361523 (Cyp2b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 361523
NCBI-ProteinID: NP_001185605
RGD: 2467
UniProt: P04167
Position
1q21
AA seq 499 aa AA seqDB search
MEPSILLLLALLVGFLLLLVRGHPKSRGNFPPGPRPLPLLGNLLQLDRGGLLNSFMQFRE
KYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGRGTIAVIEPIFKEYGVFFANGER
WKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIIC
SIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFFSGFLKYFPGAHRQISKNLQE
ILDYIGHIVEKHRATLDPSAPRDFIDTYLLRMEKVSPAWMREEKSNHHTEFHHENLMISL
LSLFFAGTETGSTTLRYGFLLMLKYPHVTEKVQKEIDQVIGSHRPPSLDDRTKMPYTDAV
IHEIQRFADLAPIGLPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDTFNPEH
FLDADGTLKKSEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSVSSHLAPKDIDLTP
KESGIAKIPPTYQICFSAR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtatcttgctcctccttgctctccttgtgggcttcttgttactcttagtc
aggggacacccaaagtcccgtggcaacttcccaccaggacctcgtccccttcccctcttg
gggaacctcctgcagttggacagaggaggcctcctcaattccttcatgcagtttcgcgaa
aaatatggagatgtgttcacagtacacctgggaccaaggcctgtggtcatgctatgtggg
acagacaccataaaggaggctctggtgggccaagctgaagatttctctggtcggggaaca
atcgctgtgattgagccaatcttcaaggaatatggtgtgttctttgccaatggggaacgc
tggaaggcccttcggcgattctctctggctaccatgagagactttgggatgggaaagagg
agtgtggaagaacggattcaggaggaagcccaatgtttggtggaggaactgcggaaatcc
cagggagccccactggatcccaccttcctcttccagtgcatcacagccaacatcatctgc
tccattgtgtttggagagcgctttgactacacagaccgccagttcctgcgcctgttggag
ctgttctaccggaccttttccctcctaagttcattctccagccaggtgtttgagttcttc
tctgggttcctgaaatactttcctggtgcccacagacaaatctccaaaaacctccaggaa
atcctcgattacattggccatattgtggagaagcacagggccaccttagaccccagcgct
ccacgagacttcatcgacacttaccttctgcgcatggagaaagtgagtcctgcatggatg
agagaggagaagtcgaaccaccacacagagttccatcatgagaacctcatgatctccctg
ctctctctcttctttgctggcactgagaccggcagcaccacactccgctatggtttcctg
ctcatgctcaagtacccccatgtcacagagaaagtccaaaaggagattgatcaggtgatt
ggctctcacaggccaccatcccttgatgatcgtaccaaaatgccatacactgatgcagtc
atccacgagattcagagatttgcagatcttgccccaattggtttaccacacagagtcacc
aaagacaccatgttccgagggtacctgctccccaagaacactgaggtgtatcccatcctg
agttcagctctccatgacccacagtactttgaccatccagacaccttcaatcctgagcac
ttcctggatgccgatgggacactgaaaaagagtgaagcttttatgcccttctccacagga
aagcgcatttgtcttggcgaaggcattgcccgaaatgaattgttcctcttcttcaccacc
atcctccagaacttctctgtgtcaagccatttggctcccaaggacattgacctcacgccc
aaggagagtggcattgcaaaaatacctccaacataccagatctgcttctcagctcggtga

DBGET integrated database retrieval system