KEGG   Rattus norvegicus (rat): 361523Help
Entry
361523            CDS       T01003                                 

Gene name
Cyp2b2, CYPIIB2, Cype
Definition
cytochrome P450, family 2, subfamily b, polypeptide 2 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q21
AA seq 499 aa AA seqDB search
MEPSILLLLALLVGFLLLLVRGHPKSRGNFPPGPRPLPLLGNLLQLDRGGLLNSFMQFRE
KYGDVFTVHLGPRPVVMLCGTDTIKEALVGQAEDFSGRGTIAVIEPIFKEYGVFFANGER
WKALRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGAPLDPTFLFQCITANIIC
SIVFGERFDYTDRQFLRLLELFYRTFSLLSSFSSQVFEFFSGFLKYFPGAHRQISKNLQE
ILDYIGHIVEKHRATLDPSAPRDFIDTYLLRMEKVSPAWMREEKSNHHTEFHHENLMISL
LSLFFAGTETGSTTLRYGFLLMLKYPHVTEKVQKEIDQVIGSHRPPSLDDRTKMPYTDAV
IHEIQRFADLAPIGLPHRVTKDTMFRGYLLPKNTEVYPILSSALHDPQYFDHPDTFNPEH
FLDADGTLKKSEAFMPFSTGKRICLGEGIARNELFLFFTTILQNFSVSSHLAPKDIDLTP
KESGIAKIPPTYQICFSAR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtatcttgctcctccttgctctccttgtgggcttcttgttactcttagtc
aggggacacccaaagtcccgtggcaacttcccaccaggacctcgtccccttcccctcttg
gggaacctcctgcagttggacagaggaggcctcctcaattccttcatgcagtttcgcgaa
aaatatggagatgtgttcacagtacacctgggaccaaggcctgtggtcatgctatgtggg
acagacaccataaaggaggctctggtgggccaagctgaagatttctctggtcggggaaca
atcgctgtgattgagccaatcttcaaggaatatggtgtgttctttgccaatggggaacgc
tggaaggcccttcggcgattctctctggctaccatgagagactttgggatgggaaagagg
agtgtggaagaacggattcaggaggaagcccaatgtttggtggaggaactgcggaaatcc
cagggagccccactggatcccaccttcctcttccagtgcatcacagccaacatcatctgc
tccattgtgtttggagagcgctttgactacacagaccgccagttcctgcgcctgttggag
ctgttctaccggaccttttccctcctaagttcattctccagccaggtgtttgagttcttc
tctgggttcctgaaatactttcctggtgcccacagacaaatctccaaaaacctccaggaa
atcctcgattacattggccatattgtggagaagcacagggccaccttagaccccagcgct
ccacgagacttcatcgacacttaccttctgcgcatggagaaagtgagtcctgcatggatg
agagaggagaagtcgaaccaccacacagagttccatcatgagaacctcatgatctccctg
ctctctctcttctttgctggcactgagaccggcagcaccacactccgctatggtttcctg
ctcatgctcaagtacccccatgtcacagagaaagtccaaaaggagattgatcaggtgatt
ggctctcacaggccaccatcccttgatgatcgtaccaaaatgccatacactgatgcagtc
atccacgagattcagagatttgcagatcttgccccaattggtttaccacacagagtcacc
aaagacaccatgttccgagggtacctgctccccaagaacactgaggtgtatcccatcctg
agttcagctctccatgacccacagtactttgaccatccagacaccttcaatcctgagcac
ttcctggatgccgatgggacactgaaaaagagtgaagcttttatgcccttctccacagga
aagcgcatttgtcttggcgaaggcattgcccgaaatgaattgttcctcttcttcaccacc
atcctccagaacttctctgtgtcaagccatttggctcccaaggacattgacctcacgccc
aaggagagtggcattgcaaaaatacctccaacataccagatctgcttctcagctcggtga

DBGET integrated database retrieval system