KEGG   Rattus norvegicus (rat): 361698Help
Entry
361698            CDS       T01003                                 

Gene name
Pold4
Definition
(RefSeq) DNA polymerase delta 4, accessory subunit
  KO
K03505  DNA polymerase delta subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno03030  DNA replication
rno03410  Base excision repair
rno03420  Nucleotide excision repair
rno03430  Mismatch repair
rno03440  Homologous recombination
rno05166  HTLV-I infection
Module
rno_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    361698 (Pold4)
   00240 Pyrimidine metabolism
    361698 (Pold4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    361698 (Pold4)
   03410 Base excision repair
    361698 (Pold4)
   03420 Nucleotide excision repair
    361698 (Pold4)
   03430 Mismatch repair
    361698 (Pold4)
   03440 Homologous recombination
    361698 (Pold4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    361698 (Pold4)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    361698 (Pold4)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      361698 (Pold4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     361698 (Pold4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 361698
NCBI-ProteinID: NP_001013213
RGD: 1308519
Ensembl: ENSRNOG00000018765
UniProt: Q6P6U6
Position
1q43
AA seq 107 aa AA seqDB search
MGRKRFITDSYPVVKKREGPPGHNKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLKPPVEVYQVLKTHPEDSRFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcacagactcctaccctgttgtgaagaagagggaggggccc
cctgggcacaacaagggggagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagttgctgaggcagtttgacctggcctggcagtatgggcct
tgcacaggtatcacaaggctgcagcgctggcatcgggcagagcagatgggcttgaagccc
cccgtagaggtgtaccaagtgttgaagacacatcctgaagactctcgcttccaatgcagc
ctctggcatctctacccactctga

DBGET integrated database retrieval system