KEGG   Rattus norvegicus (rat): 361714Help
Entry
361714            CDS       T01003                                 

Gene name
Rasgrp2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    361714 (Rasgrp2)
   04015 Rap1 signaling pathway
    361714 (Rasgrp2)
   04010 MAPK signaling pathway
    361714 (Rasgrp2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    361714 (Rasgrp2)
   04062 Chemokine signaling pathway
    361714 (Rasgrp2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    361714 (Rasgrp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 608 aa AA seqDB search
MASTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQVKTCHLVRYWVSAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNLQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcactctggacctggacaagggttgcaccgtggaggagctgctccgtggctgt
atcgaagcctttgatgactctggaaaggtgcgagatccacagctagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccacttctat
cagcaatcccggaaggacaactccaattccctacaggtgaaaacctgtcacctggtcagg
tactgggtctcagccttcccagcagagttcgacttgaacccagagctggctgaacagatc
aaggagctgaaggctctgttagaccaagaaggaaaccgcaggcacagcagcctcatcgac
atcgagagtgtccccacctacaagtggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccctgttgtttgatcacttggagcctatggaactggcagaa
catctcacctacttggagtatcggtccttctgcaagatcctgttccaggactatcacagc
tttgtgactcatggctgcactgtagacaatccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacacatttcgtgcatgtggcagagaagctgctgcagctgcagaacttc
aacacgttgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccatgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctactggcaactacagcaactaccggcgaaggctggcggcctgcgtgggcttccgc
tttcctatcctgggtgtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttcagcatt
ctggaggagttggctatggtgaccagtcttcgaccaccagtgcaagccaaccccgacctg
ctgagtctgctcacggtgtccctggaccagtatcagacggaggatgagctgtatcagctc
tctctgcagcgagagccacgttccaagtcatcgcccaccagccccaccagctgcaccccg
cctccccggccgcctgtgctggaagagtggacctcagttgccaagcctaagctggaccaa
gccttggtggccgagcacattgagaagatggtggagtctgtgttccggaactttgacgtt
gatggggacggtcacatctcccaggaggagttccagatcatccggggcaacttcccttat
ctcagcgcctttggggacttggaccagaaccaggatggctgcatcagccgcgaggagatg
atctcctacttcctgcgctccagctcggtgctgggaggccgcatgggcttcgtacacaac
ctccaggagagtaactcgctaaggccggtcgcctgccgacactgcaaagctctgatcctg
ggcatctacaagcagggcctcaaatgtagagcttgtggtgtgaactgccacaagcagtgc
aaagaccgactgtcagtggaatgtcgccgccgcgcccagagtgtgagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttctccctgcctcgc
ccaggcaggcgcagctctcggcctccagagatccgtgaagaggaggtgcagactgtggaa
gatggtgtgttcgacatccacttataa

DBGET integrated database retrieval system