KEGG   Rattus norvegicus (rat): 361714Help
Entry
361714            CDS       T01003                                 

Gene name
Rasgrp2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:rno04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:rno04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:rno04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 608 aa AA seqDB search
MASTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQVKTCHLVRYWVSAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNLQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcactctggacctggacaagggttgcaccgtggaggagctgctccgtggctgt
atcgaagcctttgatgactctggaaaggtgcgagatccacagctagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccacttctat
cagcaatcccggaaggacaactccaattccctacaggtgaaaacctgtcacctggtcagg
tactgggtctcagccttcccagcagagttcgacttgaacccagagctggctgaacagatc
aaggagctgaaggctctgttagaccaagaaggaaaccgcaggcacagcagcctcatcgac
atcgagagtgtccccacctacaagtggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccctgttgtttgatcacttggagcctatggaactggcagaa
catctcacctacttggagtatcggtccttctgcaagatcctgttccaggactatcacagc
tttgtgactcatggctgcactgtagacaatccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacacatttcgtgcatgtggcagagaagctgctgcagctgcagaacttc
aacacgttgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccatgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctactggcaactacagcaactaccggcgaaggctggcggcctgcgtgggcttccgc
tttcctatcctgggtgtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttcagcatt
ctggaggagttggctatggtgaccagtcttcgaccaccagtgcaagccaaccccgacctg
ctgagtctgctcacggtgtccctggaccagtatcagacggaggatgagctgtatcagctc
tctctgcagcgagagccacgttccaagtcatcgcccaccagccccaccagctgcaccccg
cctccccggccgcctgtgctggaagagtggacctcagttgccaagcctaagctggaccaa
gccttggtggccgagcacattgagaagatggtggagtctgtgttccggaactttgacgtt
gatggggacggtcacatctcccaggaggagttccagatcatccggggcaacttcccttat
ctcagcgcctttggggacttggaccagaaccaggatggctgcatcagccgcgaggagatg
atctcctacttcctgcgctccagctcggtgctgggaggccgcatgggcttcgtacacaac
ctccaggagagtaactcgctaaggccggtcgcctgccgacactgcaaagctctgatcctg
ggcatctacaagcagggcctcaaatgtagagcttgtggtgtgaactgccacaagcagtgc
aaagaccgactgtcagtggaatgtcgccgccgcgcccagagtgtgagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttctccctgcctcgc
ccaggcaggcgcagctctcggcctccagagatccgtgaagaggaggtgcagactgtggaa
gatggtgtgttcgacatccacttataa

DBGET integrated database retrieval system