KEGG   Rattus norvegicus (rat): 362029Help
Entry
362029            CDS       T01003                                 

Gene name
Agl
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
rno  Rattus norvegicus (rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rno00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q41
AA seq 1532 aa AA seqDB search
MEHSKQIRILLLNEMEKLEKTLFRLEQGFELQFRLGPTLQGKAVTVYTNYPFPGEAFNRE
KFRSLDWENPTEREDDSDKYCKVHLQQSGSFQYYFLQGQEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQALGLSRSCYSLADQLE
LNPDFSRPNRRYTWDDVGQLVEKLKREWNILCITDVVYNHTAANSKWIHEHPESAYNLVN
SPHLKPAWVLDRALWHLSCDVADGKYREKGVPALIENDHHMNCIRKIIWEDIFPRIQLWE
FFQVDVQKAVEQFRRLLSQENRRVTKSEPKEHLKIIQDPEFRRLGCAVDMNIALATFIPH
DNGPAAIEECCNWFRKRLEELNSEKHHLTSCHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKYPLVTRYFTFPFEEMALSAEESLLHRPDKACFLMAHNGWVMGDDPLRNFAEPGSNVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATHFQGVRLDNCHSTPLHVAEYML
DAARKLQPNLYVVAELFTGSEDLDNIFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTVVSMACCASGSTRGY
DELVPHQISVVAEERFYTKWNPGASPSDTGDVSIHSGIIAARCAINRLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYRKDENSINGMPNMTVELRERIQLHESKIVKQAGVATKGPNEYIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSSHFKSGSLAVDNSDPILKIPFASIASKLT
LAELNQVLYRCESEEQEDGGGCYDIPNWSSLKYAGLQGLMSVLAEIRPKNDLGHPFCENL
RSGDWMIDYVSGRLISRSGSIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
VAWKQMSSFVQNGSTFVKHLSLGSVQMCGVGKCPCLPLLSPSLLDVPCRLNEITKEKEQC
CASLAAGLPHFSSGLFRCWGRDTFIALRGMLLVTGRYLEARNIILAFACTLRHGLIPNLL
GEGTYARYNCRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPL
FEVIQEAMQRHMQGIQFRERNAGPQIDRNMKDEGFNITVGVDEETGFVYGGNRFNCGTWM
DKMGESDRARNRGIPATPRDGSAVEIVGLCKSAVRWLLELSKKNIFPYHEVRVRRHGKVV
AVSYDEWNRKIQNSFEKLFHVSEDPSDPNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTAEKAWKALEIAEGKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNLA
RGFNYHQGPEWLWPIGYFLRAKLYFSKMMGPETAAKTVFLVKNVLSRHYVHLERSPWKGL
PELTNENGQYCPFSCETQAWSMAAVLETLYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagtaagcagattcgaattttactattgaacgaaatggagaagctagagaag
accctcttcagacttgagcaaggatttgaactacagttccgattaggcccaactttacaa
ggaaaagctgttactgtttatacaaattacccatttcctggagaagcatttaatcgagaa
aaattccgttccttggattgggaaaacccaacagagagagaagatgattcggacaaatac
tgtaaagttcatctgcagcagtctgggtcttttcagtactacttccttcaaggacaggag
aaaagtggcggaggttacatagttgtggatcctattctgcgagttggagctgataatcac
gtgctacccttggattgtgttactctgcagacatttttagcaaagtgtttaggacccttt
gatgagtgggaaagccgactacgggtggcaaaggagtcaggctacaacatgattcacttc
accccgctgcaggctctcggactgtccaggtcatgctattcccttgccgatcagttagaa
ttaaatcctgacttctcaaggcccaatagaagatacacctgggatgatgttgggcagcta
gtagagaagctgaagagggagtggaacattctttgtattaccgatgtggtctacaatcat
actgctgctaatagtaagtggatccatgagcatccagaatctgcgtacaatcttgtaaat
tctccacacttgaaacctgcctgggtcctagacagagcgctctggcatttgtcctgtgat
gttgcagatgggaagtacagagaaaaaggagtccctgctctaattgaaaatgaccatcac
atgaactgcattcggaaaataatttgggaggacattttcccaaggattcagctctgggag
tttttccaagtagatgttcagaaagcggttgaacaatttagaagactgctctctcaagaa
aacagaagagtaactaagtctgaaccgaaagaacatcttaaaattattcaggaccccgaa
ttcaggcggctgggctgtgctgtagatatgaacattgctctggcgacctttataccacat
gacaatgggccagctgcaattgaagagtgctgtaattggttccgtaagagactcgaggag
ttaaattcagagaaacaccacctcaccagctgtcatcaggaacaggccgttaattgtctt
ttgggaaacgtgttttatgaacggctggcgggccatggccctaaactaggacccgtcacc
aggaagtaccctttagttaccaggtattttactttcccctttgaagaaatggccttgtct
gcagaagagtccctgctccaccgcccagataaagcttgctttctgatggcacacaatggc
tgggtgatgggcgatgacccgcttcggaactttgctgagccaggttccaacgtttattta
aggagagaacttatttgctggggtgacagtgtgaaattgcgctatgggaacaaaccggag
gactgcccttacctgtgggcacacatgaagaaatacactgagatcactgccactcacttc
cagggagtgcgccttgacaactgccactccacgcctctccacgtggctgagtacatgctg
gatgctgctaggaaattacagcccaatctttatgtagtggctgagctgttcacaggaagc
gaagatctggacaatatcttcgttactagactgggcatcagttccttaataagagaggca
atgagcgcatataacagtcacgaagagggcagattggtctaccggtacggaggggagccc
gtcggatccttcgttcagccctgtttgaggcctcttatgccagctatcgcgcatgccctg
tttatggacatcacccacgataatgagtgtccaattgtgcacagatcagcctatgatgcg
cttccaagtaccacagttgtctccatggcgtgttgtgctagtggaagtacaagaggctac
gacgagctagtgcctcatcagatttcagtggttgctgaagaacggttttacactaagtgg
aatcctggggcatccccatcggatacaggagatgttagcatccacagtgggattattgca
gccagatgtgccatcaacagactccatcaagagcttggagccaagggtttcattcaagtg
tatgtggatcaagtggatgaagacatagtggcagtaaccaggcactcaccaagcatccat
cagtctgttgtggctgtatcgagaacggcttttaggaatcccaagacttcattttacagc
aaagaagtgcctcaaatgtgcatccctggcaaaattgaagaggtagttctggaagctaga
actattgagaggaatacaaaaccttataggaaagatgagaattcaatcaatggaatgccg
aacatgacagtggaacttagagaacgtatccagcttcatgaaagtaaaattgtcaaacaa
gctggagttgccacaaagggtcccaatgaatatattcaggaaatagaatttgaaaaccta
tctccaggaagtgttattatattcagagttagccttgatccacatgcgcaagttgctgtt
ggaattcttcgaaatcacctgacccaattcagctcccattttaaatctggaagccttgct
gttgacaactcggatcctatattaaaaatccccttcgcttccattgcctctaaattgact
ttggctgagctaaatcaggtactttaccgatgtgaatcagaagaacaagaagacggtgga
ggttgctatgatataccaaactggtcgtcccttaagtatgcaggtctgcaaggattaatg
tccgtgctggcagaaataagaccaaagaatgacttggggcatcccttctgtgaaaacttg
aggtctggagactggatgatcgactacgtcagtggccggctaatctcacgatcagggagt
attgctgaagttggaaaatggttgcaggctatgttcttctacctgaagcagatcccgcga
tatctcatcccatgttactttgatgctatattaatcggtgcatataccactctgctggat
gtagcctggaaacagatgtcaagctttgttcagaatggctcgaccttcgtgaagcacctg
tccctgggttctgtccagatgtgtggagtcgggaagtgtccttgtctgccgctgctttca
ccctcactcctggatgtgccgtgcaggttaaatgagatcacgaaggagaaagagcagtgc
tgtgcttccttggctgcaggcttacctcacttttcttctggtctttttcgctgctggggg
agggatactttcattgcacttcgagggatgctgctggttactggtcgctacctagaagcc
aggaatattattttagcatttgcttgtaccctgaggcatggtctcattcctaacctcctt
ggcgaaggaacgtatgccaggtacaactgtcgtgatgccgtgtggtggtggctgcagtgc
attcaggactattgcaagatggttccaaatggtctagacatcctcaaatgcccagtttcc
agaatgtatccaacagatgactctgcacctttgcctgctgggactctggatcagcctttg
tttgaagtcatacaggaagctatgcagaggcacatgcaaggcattcagttccgagagcgg
aatgccggtccacagatcgatcgaaacatgaaggatgagggtttcaacataaccgtgggg
gttgatgaagaaacaggatttgtttatggaggaaatcgcttcaactgtggcacatggatg
gataaaatgggagagagtgacagagctagaaacagagggatcccagccaccccaagagat
gggtctgctgtggaaatcgtgggcttgtgtaaatctgctgttcgttggttgctggaattg
tccaagaaaaacatttttccttatcatgaagtcagagtaagaagacatggaaaggttgta
gcagtctcctatgatgagtggaacagaaaaatacaaaacagttttgaaaagctctttcat
gtttccgaagacccttcagatcctaacgagaagcatccgaatctggttcacaagcggggc
atctacaaggacagctacggtgcgtcaagtccttggtgtgactatcagctcaggcccaac
tttaccatagcaatggtcgtggcccctgagctctttactgctgaaaaggcttggaaggct
ttggaaattgcagaaggaaaattgcttggtccccttggcatgaagactttggatccagat
gacatggtttactgtggagtctatgacaatgccttagacaatgacaactacaaccttgcc
agaggtttcaattaccaccaaggacctgagtggctatggccgattgggtattttcttcgt
gcaaagttgtatttttccaaaatgatgggcccagagactgctgcgaagactgtatttttg
gttaaaaatgttctttctagacattatgttcatcttgagagatccccatggaaaggactt
ccagagctcaccaatgagaatggccagtactgccctttcagctgtgagacacaggcatgg
tcgatggctgctgttctcgaaaccctctatgatctatag

DBGET integrated database retrieval system