KEGG   Rattus norvegicus (rat): 362092Help
Entry
362092            CDS       T01003                                 

Gene name
Brd3
Definition
(RefSeq) bromodomain containing 3
  KO
K11721  
bromodomain-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  BRD family [OT]
   362092 (Brd3)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    362092 (Brd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p12
AA seq 725 aa AA seqDB search
MSTTTAAAPTGIPAVPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQNAGAQQMGAVSSVSPA
PPFQNIPPTVSQTPVIAATPVPTITANVTSVPVPPPAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSEPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPM
EVPALPAPTAPIVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKAKSEEEKKAKAAPAAKQAQQKKAPTKKA
NSTTTASRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPLSTSGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLNSKKPTKKEKSGSAPSGGPSRLSSSSSSESASSSSSGSSSD
SSDSE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtccactactacagcggctgcccccacggggatcccggcagtcccgggccccgtgaac
cctcccccacctgaggtctccaaccccagcaagcccggccgaaagactaaccagctgcag
tacatgcagaacgtagtggtgaagacactctggaaacatcagtttgcctggcctttctac
cagcctgtggatgcaatcaagctgaacctgcctgattatcataaaataataaaaaaccca
atggacatggggactatcaagaagagactagaaaataattattattggagtgccagtgag
tgtatgcaggacttcaacaccatgtttacaaactgttatatttataataagcccacagat
gacatagtgctaatggcccaggccttagagaaaatctttctgcagaaagtggcccagatg
cctcaggaggaagttgaactattgccccctgctccaaagggcaaaggccggaagccagct
gcaggagcccagaatgcaggtgcacaacaaatgggagctgtgtcctcggtctccccagca
ccccccttccagaacataccccccaccgtatcccagacacccgtcattgccgccacccct
gtaccaaccatcactgcaaacgtcacgtcagttccagtccccccacccgccgcaccgcct
cctcctgcgacacccatcgtcccagtggtccctcccacaccgcctgtagtcaagaaaaag
ggcgtgaagcggaaagcagacacaaccacacccacaacgtccgccatcactgccagccgg
agtgagtctcccccgccactttcagagcccaagcaagccaaggtagtagcccgaagagag
agcgggggtcgccccatcaaacctcccaagaaggacctggaagatggtgaggtcccacag
cacgcgggtaaaaagggaaaactgtccgagcacctgcggcattgtgacagcatcctccgg
gagatgctgtccaagaagcacgctgcctatgcgtggcccttttacaagccagtggatgcc
gaggcactggagctgcatgactaccatgacataatcaaacaccccatggaccttagcaca
gtcaaaaggaaaatggacagccgtgagtacccagatgcacagggcttcgctgccgatatc
cggttaatgttctccaattgttataagtacaaccctccagaccacgaagtggtagccatg
gccaggaagctccaggatgtgtttgagatgaggtttgccaagatgcccgatgagcccatg
gaggtgcctgcgctgcctgctcccacagcccccatcgtgagcaaaggggctgagagcagc
cgtagtagcgaggagagctcttcggactcaggcagctcagactctgaagaggagcgagcc
actcggctggcagagctgcaggagcagctgaaagccgtgcacgaacagctggccgccttg
tctcaggccccagtgaacaaaccaaagaagaagaaggagaagaaggaaaaggagaagaag
aagaaagacaaggagaaggagaaggagaagcacaaggccaagtccgaggaggagaagaag
gccaaggcagccccagcagccaagcaggcccagcagaagaaggctcccaccaagaaggcc
aatagcacaaccacagccagcagacagctcaagaagggcggcaagcaggcatctgcatcc
tatgactcggaggaagaggaggagggcctgcccatgagctacgatgagaagcggcaactc
agcctcgacatcaaccggctgcctggcgagaagctaggtcgtgtggtgcacatcattcag
tcccgggagccttcccttcgggactcgaacccagacgagattgagattgactttgagacc
ctgaagccaaccacacttcgggaactggagagatatgtcaagtcttgtttacagaaaaag
cagaggaaaccattgtcaacaagcgggaagaagcaggcagccaaatcgaaagaggagcta
gctcaggagaagaaaaaggagctggagaagcggctacaggatgtcagcggacaactgaac
agcaagaaacccactaagaaagagaagtccggctcagctccctcaggaggcccatcaagg
ctcagcagtagcagctcctccgagtctgcgagtagcagctccagtgggtcaagctctgac
agcagtgactcagagtga

DBGET integrated database retrieval system