KEGG   Rattus norvegicus (rat): 362281Help
Entry
362281            CDS       T01003                                 

Gene name
Rae1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:rno03013]
Human Diseases; Infectious diseases; Influenza A [PATH:rno05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPVAACGFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctctggttttgggactggtgggaccagcatgtttgggagc
acaaccacagataaccataacccaatgaaggatattgaagtaacgtcttctcctgatgac
agcatcggttgtctgtctttcagcccaccaaccttaccagggaacttccttattgcagga
tcgtgggctaatgatgttcgctgctgggaagtgcaagacagcgggcaaaccattccaaag
gcccagcaaatgcataccgggccagtgcttgatgtctgctggagtgacgatgggagcaaa
gtgttcacagcatcgtgtgacaagacagccaagatgtgggacctgaacagcaaccaggcc
attcagatagcacagcacgatgctcccgttaagaccatacattggatcaaagccccaaac
tacagctgcgtgatgaccgggagctgggataagaccctgaagttttgggatacccggtcg
tcaaatcctatgatggtcctgcagctccctgagcgctgttactgtgcagatgtgatctat
ccgatggctgtggtggccactgcagaaaggggcctgattgtgtaccagttggagaaccag
ccctctgagttcaggaggatagagtctccactgaagcaccagcatcggtgtgtggctatc
tttaaagacaaacagaacaagccaacgggttttgctcttgggagtattgaggggagagtg
gccattcactacatcaaccctccaaatccggccaaagataacttcaccttcaaatgccat
cgatccaacggtaccaacacttctgctcctcaagacatctatgcagtgaacggcatcgcc
ttccaccctgtccatggcaccctggccactgtggggtccgacggccggttcagcttctgg
gacaaagatgccaggacaaagctgaagacctcagagcagctggaccagcccgtggcagcg
tgtggcttcaaccacaacgggaacatatttgcctatgcctccagctacgactggtccaag
gggcatgagttttataatccccaaaagaaaaattacattttcctgcgtaatgcagctgaa
gagctaaagccaagaaataaaaagtag

DBGET integrated database retrieval system