KEGG   Rattus norvegicus (rat): 362332Help
Entry
362332            CDS       T01003                                 

Gene name
Flnc, ABP-L, FLN-C
Definition
(RefSeq) filamin C
  KO
K04437  
filamin
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    362332 (Flnc)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    362332 (Flnc)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    362332 (Flnc)
  Infectious diseases
   05132 Salmonella infection
    362332 (Flnc)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     362332 (Flnc)
  Intermediate filaments
   Intermediate filament-binding proteins
    362332 (Flnc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362332 (Flnc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q22
AA seq 2726 aa AA seqDB search
MMNNSNYSDASGLGLLDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VIPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDRGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTVIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGEEQAFLVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGS
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYVPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPAEVLQLHQPYAPLRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
GHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITEGDLSQLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGASYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVK
EKGDYILIVKWGDESVPGSPFKVNVP
NT seq 8181 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcaactactccgacgcctccggcctcggcctgcttgacgaggcggac
gagatgccgtccaccgagaaggacctagcggaggacgcgccgtggaagaagatccagcaa
aacacattcacgcggtggtgcaacgagcatctcaagtgtgtgggcaagcggctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaagtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccagatgaagctggaaaat
gtgtctgtggccctggagttcctggagcgcgaacacatcaagctcgtgtccatcgacagc
aaggccatcgtggatgggaacctgaagctaatcctgggcctgatctggacactgatcctt
cactactccatctctatgcccatgtgggaggatgaagacgatgaggatgcccgcaaacag
acgcccaagcagcgactgctcggctggatccagaacaaagtgccccagctgcccattacc
aactttaacagggactggcaggacggcaaggctctgggtgccctggtggacaactgtgcc
cctggtctctgccctgactgggaagcctgggaccccaaccagcctgtgcagaatgccaga
gaagccatgcagcaagccgatgactggctcggggtgccccaggtgattgcccctgaagag
atcgtggatcccaacgtggatgagcactctgtcatgacctacctgtcccagttccccaag
gccaagctcaaacccggtgcccctgtccgctctaagcagctgaatcccaagaaagccatt
gcctacgggcccggcattgagccccagggcaacaccgtgctgcagcctgcccacttcact
gtgcagacagtagatgctggtgtgggtgaggtgctggtctacatcgaggaccccgagggt
cacactgaggaggccaaagtggttcccaacaacgacaaggaccgcacatacgcagtctcc
tatgtgcccaaggttgctgggttacacaaggtgacggtcctcttcgctggccagaacatc
gagcgtagtccctttgaggtgaatgtgggcatggctctcggggatgccaacaaggtatca
gcccgtggccctggtctggaacctgtgggtaatgtggccaacaaacccacctactttgac
atctatactgctggggctggcactggtgatgttgccgtggtgatcgtggacccacagggg
cggcgagatacagtagaggtggccctggaggacaaaggtgacaacacattccgatgcaca
tacaggcccgtgatggaagggccacacaccgtgcatgtggcctttgccggtgcacccatc
acccggagtcccttccccgtccatgtggcagaagcttgtaatcccaacgcctgcagagcc
tctgggcgaggcctgcagcccaaaggtgtgcgtgtgaaggaggtggctgacttcaaggtg
ttcaccaagggtgctggcagcggggaactcaaggtcacagtcaagggtccaaagggcaca
gaggagccagtgaaggttcgggaggctggagacggtgtgttcgagtgcgagtactaccca
gtgatacctgggaagtatgtggtgaccatcacttggggtggctatgccatcccccgcagt
ccttttgaggtccaggtgagcccagaggccggagcccagaaagtacgggcatggggtcct
ggtttggagactggccaggtgggcaagtcagctgacttcgtggtggaagccattggcaca
gaagtggggacgctgggcttctctattgaggggccctcgcaagccaagatcgagtgtgat
gacaggggtgatggctcctgtgacgtgcggtactggcccacggagcccggggagtatgct
gtgcacgtcatctgtgacgatgaagacatccgggactcacctttcatcgcccacattcag
ccagccccaccagactgcttcccagacaaggtgaaagccttcggacctggtctggagccc
actggctgcatcgtagacaggcctgcggagttcaccattgatgcccgtgctgctggcaag
ggagatttgaagctctatgcccaggatgcagatggctgccccatcgacatcaaggtgatc
cccaatggtgatggcaccttccgctgctcctacgtgcctaccaagcccattaagcatacc
gtcattatctcttggggaggtgtcaacgtgcccaagagccccttcagggtgaatgtagga
gaaggcagccatcctgagcgggtaaaagtatatggccctggagtggagaagacaggcctg
aaagccaacgaacccacctatttcacagtggactgcagtgaagctgggcaaggtgatgtg
agcattggcatcaaatgtgcccctggcgtggtggggcccgcggaagctgacatcgatttt
gacatcatcaagaatgacaatgacaccttcacagtcaagtacacacccccaggggccggc
cactacacgatcatggtgctgtttgccaaccaggaaatccctgccagtcccttccacatc
aaggtggacccgtcccacgatgctagcaaggtcaaggctgagggccctgggctgagccgc
acaggtgtggaagtcggaaagccaactcacttcactgtgctgaccaagggagctggcaag
gccaaactggacgtgcacttcgctggggcagccaagggcgaggctgtgcgagactttgaa
atcatcgacaaccatgactattcgtatactgtcaagtacactgctgtccagcagggcaac
atggcagtaacggtgacctacggtggagaccctgtccccaaaagtcccttcgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagtccaaggcctgaacagcaaggtagct
gtgggagaggaacaagcgttcttggtgaacaccagaggggctggtggtcagggccaacta
gatgtgcggatgacctcaccctcccgacggcctatcccctgcaagctggaacctgggagt
ggagcagaagcccaggctgtccgctacatgccccctgaagaaggaccttacaaggtggac
atcacctatgatggtcacccagtgcctggcagcccctttgctgtggaaggcgtcctgccc
cctgacccctccaaggtctgcgcgtatggccctggtctcaagggtgggctagtaggcacc
ccggcaccattctccattgacaccaagggggccggcacaggaggcctggggctgactgtc
gagggcccctgcgaagccaagatcgagtgccaagacaatggtgatggatcttgtgcagtt
agctacctgcccacagagccaggcgagtacaccatcaatatcctgttcgctgaagcccac
atccctggctcacccttcaaggccaccatccagcctgtgttcgacccaagcaaggtgagg
gccagtgggccaggcctggagcgtggcaaggccggagaggcagccaccttcactgtggac
tgctcggaagcgggcgaggccgagctgaccatcgagatcctgtcagacgctggtgtcaaa
gcggaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagtcctgcc
ttcccaggcacctacaccatcaccatcaagtatggcggccaccccatacccaagttcccc
acccgtgtccacgtgcagcctgcagttgataccagtggcatcaaggtctctgggcctggt
gtggaaccacatggtgtcctgcgggaggtgaccaccgaatttactgtggatgcaagatct
ctgacagctacaggtggcaaccacgtgacagctcgtgtgctcaacccctcgggtgctaag
acagatacctatgtgacagacaacggggatggcacctaccgggtgcagtacacggcctac
gaagagggtgtgcatttggtggaggtgctgtatgacgaagtagccgtgcccaagagcccc
ttccgagtgggtgtgacggagggctgtgaccccacccgagtccgggccttcggaccaggc
ctagagggtggcttggtcaacaaggccaaccgcttcactgtggaaactaggggtgctggc
acaggaggccttggcctagccatcgagggcccctcagaagctaagatgtcctgcaaggac
aacaaagatggcagttgcactgtggagtacgtccccttcactcctggggactatgatgtc
aacatcacctttgggggacaacccatcccaggaagcccattccgagttcctgtgaaggat
gttgtggaccctgggaaggtgaagtgttcagggccagggctagggactggcgtcagggct
cgggtacctcagaccttcacagtggactgcagtcaagctggccgggcccctctacaggtg
gcagtgctgggacccacaggtgtggctgagcctgtggaggtgcgtgacaatggcgacggt
acccacactgtccactacacgcctgccactgacggaccctatacagtagctgtcaagtat
gctgaccaggaggtgccacgcagccctttcaagatcaaagtgcttccggcccacgatgcc
agcaaagtgcgggccagtggccctggcctcaatgcctccggcatccccgccagcctgccc
gtggagttcaccattgatgctcgtgatgctggtgaggggcttctcacagtccagatcctg
gatcccgagggtaaacccaagaaggccaacatccgagacaatggggatggcacatacacc
gtgtcctacctgccagacatgagtggtcggtacaccatcaccatcaagtatggcggcgat
gagatcccttactcacccttccgtatccacgccctgcctacaggggatgccagcaagtgc
cttgttacagtatccattggaggccatggactgggtgcctgcctgggtcccagaatccag
attggagaggagactgtgattacagtggatgccaaggcagcaggcaaggggaaggtgacc
tgcacagtatccacacctgacggggcagagctcgatgtggatgtagttgagaaccacgat
ggtacctttgatatctactacacagcacctgagccgggcaaatatgtcatcaccatccgc
tttgggggtgaacacattcccaacagccccttccatgtgctggcatgtgacccgctgcct
catgtggaggagcctgcggaagtgctgcagctgcaccagccatatgccccacttcggcct
ggcacctgccccacacactgggccacagaggagcccgtggttcctgtggagcctttggag
tccatgctgaggcctttcaacttggtcatcccattcactgtgcagaaaggggagctgaca
ggggaggtccggatgccctctggtaaaacagcacgtcccaacatcactgacaacaaggac
ggtaccatcacagtgagatacgcacctacagagaaaggcctgcaccagatgggaatcaag
tacgatggcaaccatatccctgggagccctctgcagttctatgtggatgccatcaacagc
gggcatgtcagtgcctatgggccaggtctgagccatggcatggtcaacaagcctgccacc
ttcacaattgtcaccaaagacgctggggaaggggggctgtcactggctgtggagggccca
tccaaggcggagatcacctgcaaggacaacaaagatggcacctgtaccgtgtcctaccta
cccacagcacctggagactacagcatcattgtgcgctttgacgacaagcatatcccaggg
agccccttcacggccaagatcacaggtgacgactcaatgagaacgtcccagcttaatgtg
ggcacctccaccgatgtgtcactgaagatcacagagggtgacctcagccagctgacagcc
agtatccgtgctccttcaggcaatgaggagccttgcctgctgaagcgcttgcccaacagg
cacattgggatctcctttacccccaaggaggtcggtgagcatgtggtgagcgtacgcaag
agtggcaagcacgtcaccaacagcccctttaagattttggttgggccttcggagatcggc
gatgccagcaaagttcgagtctggggcaagggcctttccgagggacagaccttccaagtg
gcagagttcattgtggacactcgcaatgcaggctacggaggcctggggctgagcatcgaa
ggtcctagcaaggtggacattaactgtgaggatatggaagacggtacctgcaaagtcacc
tactgtccaactgaacctggcacctacatcatcaacattaagtttgctgacaaacacgtg
cctggaagtcccttcaccgtgaaggtgactggcgagggacgcatgaaggagagcatcacc
cggcgcagacaggcgccttccatcgccaccattggtagcacctgtgacctcaacctcaag
atcccaggaaactggtttcagatggtgtccgcccaggagcgcctgactcgcaccttcacg
cgtagcagtcacacgtacacccgcacggagcggacagagatcagcaagactcggggtggg
gagaccaagcgtgaagtccgggtggaggagtccacccaggtcggcggagaccctttccct
gctgttttcggcgattttctcggccgggaacgcctgggctcctttggaagcatcacccga
cagcaggaaggtgaggccagctctcaggacatgacagcccaggtgaccagtccatctggc
aagacagaagccgcagagatcgttgagggagaagacagcgcatacagtgtgcgctttgtg
ccccaggagatgggcccccacacagtcgctgtcaagtaccggggccaacatgtgcctgga
agcccttttcagttcaccgtgggtccgctaggtgaaggtggtgcccacaaggtgcgggct
ggaggcacagggctggagcgaggtgtagctggtgtgccagctgagtttagcatctggacc
cgagaagctggagctgggggcctgtccattgctgtggaaggtcccagcaaggcagagatc
gcattcgaagaccgcaaagatggttcttgtggtgtctcctatgttgtccaggagccaggt
gactatgaggtctccatcaagttcaatgatgagcacatcccagacagcccctttgtggtg
cctgtggcctccctctcagatgatgctcgccgcctcaccgtcaccagcctccaggagaca
gggcttaaggtgaaccagccagcatctttcgcggtgcagcttaatggggcacgtggcgtg
atcgatgcccgggtacacacaccctcaggagctgtggaggagtgctatgtctctgaactg
gacagtgataagcataccatccgcttcatcccccatgagaacggtgtccactcaattgat
gtcaagttcaacggtgcccacatccctggaagccccttcaagatccgcgttggggagcag
agccaagctggggacccaggcttggtgtcagcttatgggcctgggcttgaaggaggcact
acgggtgtatcgtcagagttcattgttaacacccagaatgcaggctcgggggccttgtct
gtcaccatcgatgggccttccaaggtgcagctggactgtcgggagtgtcctgagggccat
gtagtcacttacacgcccatggctcctggcaactacctcattgccatcaagtatggcggc
cctcagcacattgtgggcagtcccttcaaagcaaaggtcacaggtccccggttgtctgga
ggccacagccttcacgaaacatccacagttctggtggagactgtgacaaagtcctcctcg
agccgcggcgccagctacagttccatccccaagttctcctcagatgccagcaaggtggtg
acaaggggccccggcctgtcccaggcctttgtgggtcagaagaactccttcaccgtggac
tgcagcaaagcaggtaccaacatgatgatggtgggtgtgcacgggcccaagaccccctgc
gaagaggtatatgtgaagcacatggggaaccgggtctacaatgtcacctacactgtcaag
gagaaaggagactacatcctcattgtcaagtggggtgatgaaagtgtccctggaagcccc
ttcaaggtcaatgtgccctga

DBGET integrated database retrieval system