KEGG   Rattus norvegicus (rat): 362335Help
Entry
362335            CDS       T01003                                 

Gene name
Nup205
Definition
nucleoporin 205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    362335 (Nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q22
AA seq 2008 aa AA seqDB search
MAALLAVNSAASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFISLFKNPPKN
VQQHEKIQKASSEGVAIQGQQGTRLLPEQLIKEAFIISDLFDIGELSAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKTLIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRDRGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LAKDDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDTSFIEQSTEERDDMIHHLPL
LTERQYIATIHSRLQDSQPWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAIA
ELAIADNVFLFLSESVVLAENFYQEEFYIRRIHNLITDFLAFMPMKVKQLKNRADEDARM
IHMSIQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPSEPLQTPTVMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLLLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPALKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKMVGDFTHDQNVSQKLMAGFVECLDSEDT
EEFVRVEEGSELEKKLAAIRHETRIHILNLLITSLERSPPNLALYLLGFELKKPISTTNL
QDPGVLGCPRTCLHAILNILEKGTDGRSGPVAVQACPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDLPVKPYSDGEGGMEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLQGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQELIQAEDRQLIIRDILQDVHD
KVLDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVSGPAEAHYAFMLDSSFTSAPA
AESQPVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLLEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKLQQGSLELLRSGVIVRLAQCQVYDMRPEVDSHSMFGMRDPPIFIPTPVDRYRQIL
LPALQLCQVILTSSMSQHLQAAGQVLQFLVSHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGMLNELDVDVNEGSLMELQGHIARFQRQCLGLLSRFGGSDRLRQFKLQEDNVEG
DRLSKKDEIELAMQQICANVMEYCHSFMQQNSPNLQNAVCLFTPSLSETVNRDGARQDTQ
VPVVPYWRLPGLGIIIYLLKQSASDFFSYYDSHRRSVNKLQNVEQLPPDEIKELCQSVMP
AGIDKISTAQKCVLARRRLVKLINNRAKLLSLCSYIIETCLFILWRHLEYYLLHCTPMDS
QDSLFASRTLLKSRRLQEPNLDFSRSGLAQVNQHDIDQLQSDAINAFGESLQKKLLDIEG
LYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6027 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgttggcggtaaattcggctgccagcctatggggaccctacaaggacatc
tggcagacagtcggaaatgctctttggagaagacagcctgaagctgtccacctccttgac
atgattttgaagaaacacaaacccgacttcatttcactatttaaaaacccaccaaaaaat
gttcaacagcatgaaaagattcagaaagccagttcggagggtgtcgccattcaggggcaa
caaggaaccagacttctccctgagcaactcattaaagaagcatttatcatcagtgacctt
tttgacattggggaattgtcagctgttgagcttctccttgctggagaacatcagcaacca
catttccctggcctcaccagaggattggtagctgtccttttatactgggatggaaagcgg
tgcattgcaaactctctcaaaaccctaatacagtctagacgagggaagacatggacatta
gaactcagtccagagctggtttccatgacaacacgctttacagatgagctgatggaacaa
ggattgacttacaaagtccttactttggtgtcacagattgatgtgaataatgaatttgag
aaactacagagagacagaggtttgggcagtgagaaacaccgcaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggctgaaagtctttttgcttgggcttgccagtcaccg
ttagctaaagatgacaccctcctgcttattggacatttagaaagagtgacagtcgaggcc
aacggctccctggatgcagtaaatctggctctcctcatggctcttctgtactgttttgat
accagctttatagaacaaagcacagaggaacgagatgatatgattcaccaccttcccctg
ttgacagagagacagtacattgccacaattcactctcgcctccaggactcccagccttgg
aagctacctgggctgcaggccactgttagacttgcctgggcactggcactgagggggata
tcccagctacctgatgtgacagccctggctgagttcacggaagcagatgaagcgattgca
gaactcgccattgccgataatgtcttcctgttcctcagcgagtctgtcgtgctggctgaa
aacttctatcaggaagagttttatattcgcagaatccataatcttattacagacttcctt
gcatttatgccaatgaaagtgaagcagctgaagaatcgggcagatgaagatgctcgaatg
attcacatgagtatacagatgggtaacgaaccccccatctcacttagaagggacctggaa
cacttgatgctcctgattggtgaactatataaaaaaaacccttttcatttggagcttgct
ctggagtactggtgtccctcagagcctctgcagactcccacggtcatgggctcttacctg
ggagtagctcatcagcgccctcctcagcgccaggttgtcttgtcaaagtttgttagacaa
atgggtgatctgttgccgccaactatttacattccttatttgaagatgctccagggcttg
gccaatgggcctcagtgtgcccactactgttttagcctgctcaaagtcaacggtagtagt
catgttgaaaacattcagggagcaggtggcagtcctgtttcctgggagcatttcttccac
tccttattgctctatcatgagcatctccgaaaggacctgccaagtgcagatagtgtccag
taccggcaccttccttcacgcggcatcacccagaaggagcaagatgggctgatcgctttt
ctccagctgacatctactatcattacttggagtgaaaatgctcgcctggcgctctgtgaa
catccccagtggactcccgttgtggtgattttggggctcctgcagtgcagtattcctcca
gctctcaaagctgagctactgaagacacttgcagcttttgggaagtctcctgaaattgcc
gcttctctctggcagtcattggagtacacgcagatactgcagactgtcagggttccaagc
cagaggcaagctattggtattgaggttgaactcaatgaaatagagtcccggtgtgaagag
tatcccctgactagggccttttgccagttgatcagtaccctggtggagagctcattccct
tctaatctgggtgctggcctgcgcccccctggctttgacccttatttgcagttcctgaga
gattctgtgtttctccgattccgtacaagagcttaccggagagccgctgaaaagtgggaa
gtcgctgaggttgtcctggaagtgttttataagctgttgagagattatgagccccagctt
gaagattttgtagatcagtttgtggagctacaaggagaagagatcatagcctataagcca
cctgggtttagtctgatgtaccatcttctgaacgagtcaccgatgttggaacttgccctc
agcttactggaagaaggagttaagcagcttgatacctatgctcctttccctggaaagaaa
cacctggaaaaagcagttcagcattgcctcgcactcctcaacctcactctgcaaaaggag
aaccttttcatggaccttctgagagagagtcagctggctctcatcgtctcgcctctggaa
cagctcttgcagggaattaaccctaggactaagaaggcagacaatgtggttaacatcgcc
aggtatctgtatcatggaaacagtaatcctgaattggcatttgaaagtgcaaagatcctc
tgctgtatctcttgcaattccaacattcagatcaaaatggttggcgatttcacacatgac
cagaatgtgagccagaagctgatggctggatttgtagagtgcttggatagtgaagacaca
gaagaatttgtacgtgtagaagagggctcagaattagaaaagaaattagctgcaatccgt
cacgaaacgagaatccacatcttgaatcttctcatcacatctctagaacgcagtccaccc
aatctcgccctctacctgttgggctttgaattgaagaaacccatcagtaccacgaatctg
caagacccaggagtactaggctgccctcggacgtgccttcatgccatcctgaacattctg
gagaaaggcaccgacgggaggagcggccctgtggccgtgcaggcgtgtccacagctggcc
gagctgtgctaccaggtgatatatcagttatgtgcatgctcagatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttctcagttgcaacatctacctttc
tcgaacaaagagtatgaaatctctatgctgaatcaaatgtcatggcttatgaagactgcc
tcaatagagctaagagtgacgtctctgaatcgccagcgctcacacacacagaggcttctg
catctcttactggatgacctgccggtgaagccgtactctgatggtgaaggaggaatggaa
gatgaaaatagatctgtctctgggttccttcattttgacactgccacaaaagtgcgtcga
aaaattctaagtattcttgattcgattgacttcagtcaggagattcctgagcctttgcag
ctggatttttttgaccgtgcccagattgagcaagtcattgccaattgtgagcacaagaat
ttacaggggcagacggtctgcaatgtcaagcttcttcatagggttctcgtagctgaagtc
aatgctcttcagggtatggcagcaataggccagaggccgctgctgatggaggaaatcagc
actattcttcagtatgtcgtaggaagaaacaagttgctgcagtgtcttcatgcaaagcgg
catgcactggaatcctggaggcagctggtagaaattatcctgacagcttgtcctcaggag
ctcattcaggcagaagatcggcagctgattattcgtgacattttacaagatgtgcatgat
aaggtgctggatgatgaagccgcacaggagctaatgccagtggttgccggtgctgtgttc
accctgactgctcacctaagccaggctgtgcgcacggaacagaagcagccattggtctca
ggacctgcagaggcccattatgctttcatgcttgatagttctttcacctcagctcctgca
gcagagagccagccggtgggctttgcttctattggagattcttcacttcatatcatactg
aagaaactgttggacttcattttgaagacaggtggtggcttccagcgtgtaaggactcac
ctgtatggctcgctgctttattacttacagattgcccagagaccagatgagccggacaca
ttagaagctgctaagaaaactatgtgggaaaggctgactgcccctgaagatgtgtttagt
aaattacagcgagaaaacatggctatcattgagagttacggcgctgcgctcatggaggtg
gtctgtcgagatgcttgcgacggtcatgagattggaaggatgctggccctggctctcctt
gatcggattgtctctgtggacaagcagcagcagtggctcttgtacctttctaacagtggc
tatttgaaggtccttgtagacagcttgctggaagatgatcgcactctacagagcttgctg
actccacagcctcctctcttaaaagccctttatacctatgagtccaagatggcatttctc
acaagagtggctaagctacagcaaggttcattagaactcctaagatcaggggtgattgtg
aggctggcacagtgccaagtctatgatatgcgcccagaagtggactctcatagcatgttt
ggcatgagagacccaccaatattcatcccaacgcctgtggaccgataccggcagattctc
cttccagccctccagctatgccaggtcatcctcacatccagtatgtcccagcacttgcag
gcagcagggcaggtgctgcagtttctcgtttcacattctgataccatccaagcgattctg
cgctgccaggatgttagtgctggctctttgcaggaattagccctgctgacaggaatcata
agtaaagcagcgcttcctggtatgttaaatgaacttgatgtagatgtaaatgaaggatcc
ttaatggagctccagggacacatcgcaaggtttcagcgccagtgcctaggcctactgagt
cgcttcggtggctctgacagactgcggcagtttaaactccaagaagataatgtggaggga
gacaggttgagcaagaaagatgaaattgagctggccatgcagcagatttgtgccaatgta
atggaatattgccattcgttcatgcagcagaactcccctaacctccagaatgctgtgtgt
ctcttcacccctagcctttccgagacggttaacagagatggagcacggcaagatacccag
gttccagtcgttccatactggcgcctgcctggcttgggcattattatctacctgctgaaa
cagagtgccagcgatttctttagctattatgacagtcaccgtcgcagtgtcaacaagctg
cagaatgtagaacaacttcctccagatgagataaaagagttatgccagtctgtgatgcct
gctggcattgataaaatctctacggcgcagaagtgtgtcttagcaagacggcgtctggtg
aagctgatcaacaaccgagccaaactgctgtccctctgctcttatatcatcgagacctgc
ctgtttattctttggcgccatctggagtattacttgttacattgcactccaatggattcc
caagattcactgtttgcctctaggactttacttaaaagcagaagactacaggagcccaat
ctggacttcagcagaagtggactggctcaagtgaaccagcacgatatagaccagctgcag
tctgatgccatcaacgcttttggagaatcactgcaaaagaaactgcttgacatcgaaggg
ttgtattcaaaagttcgatcccgctatagcttcatacaggctcttgtcagacgtatccgt
ggtctgctgaggatatcaaggaactga

DBGET integrated database retrieval system