KEGG   Rattus norvegicus (rat): 362335Help
Entry
362335            CDS       T01003                                 

Gene name
Nup205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  nuclear pore complex protein Nup205
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Module
rno_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    362335 (Nup205)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     362335 (Nup205)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    362335 (Nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 362335
NCBI-ProteinID: NP_001102090
RGD: 1309413
Ensembl: ENSRNOG00000010852
UniProt: D4A7R3
Position
4q22
AA seq 2008 aa AA seqDB search
MAALLAVNSAASLWGPYKDIWQTVGNALWRRQPEAVHLLDMILKKHKPDFISLFKNPPKN
VQQHEKIQKASSEGVAIQGQQGTRLLPEQLIKEAFIISDLFDIGELSAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKTLIQSRRGKTWTLELSPELVSMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRDRGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LAKDDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDTSFIEQSTEERDDMIHHLPL
LTERQYIATIHSRLQDSQPWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAIA
ELAIADNVFLFLSESVVLAENFYQEEFYIRRIHNLITDFLAFMPMKVKQLKNRADEDARM
IHMSIQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPSEPLQTPTVMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLLLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPALKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVSPLEQLLQGINPRTKKADNVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKMVGDFTHDQNVSQKLMAGFVECLDSEDT
EEFVRVEEGSELEKKLAAIRHETRIHILNLLITSLERSPPNLALYLLGFELKKPISTTNL
QDPGVLGCPRTCLHAILNILEKGTDGRSGPVAVQACPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDLPVKPYSDGEGGMEDENRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLQGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TILQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQELIQAEDRQLIIRDILQDVHD
KVLDDEAAQELMPVVAGAVFTLTAHLSQAVRTEQKQPLVSGPAEAHYAFMLDSSFTSAPA
AESQPVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLLEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKLQQGSLELLRSGVIVRLAQCQVYDMRPEVDSHSMFGMRDPPIFIPTPVDRYRQIL
LPALQLCQVILTSSMSQHLQAAGQVLQFLVSHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGMLNELDVDVNEGSLMELQGHIARFQRQCLGLLSRFGGSDRLRQFKLQEDNVEG
DRLSKKDEIELAMQQICANVMEYCHSFMQQNSPNLQNAVCLFTPSLSETVNRDGARQDTQ
VPVVPYWRLPGLGIIIYLLKQSASDFFSYYDSHRRSVNKLQNVEQLPPDEIKELCQSVMP
AGIDKISTAQKCVLARRRLVKLINNRAKLLSLCSYIIETCLFILWRHLEYYLLHCTPMDS
QDSLFASRTLLKSRRLQEPNLDFSRSGLAQVNQHDIDQLQSDAINAFGESLQKKLLDIEG
LYSKVRSRYSFIQALVRRIRGLLRISRN
NT seq 6027 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgttggcggtaaattcggctgccagcctatggggaccctacaaggacatc
tggcagacagtcggaaatgctctttggagaagacagcctgaagctgtccacctccttgac
atgattttgaagaaacacaaacccgacttcatttcactatttaaaaacccaccaaaaaat
gttcaacagcatgaaaagattcagaaagccagttcggagggtgtcgccattcaggggcaa
caaggaaccagacttctccctgagcaactcattaaagaagcatttatcatcagtgacctt
tttgacattggggaattgtcagctgttgagcttctccttgctggagaacatcagcaacca
catttccctggcctcaccagaggattggtagctgtccttttatactgggatggaaagcgg
tgcattgcaaactctctcaaaaccctaatacagtctagacgagggaagacatggacatta
gaactcagtccagagctggtttccatgacaacacgctttacagatgagctgatggaacaa
ggattgacttacaaagtccttactttggtgtcacagattgatgtgaataatgaatttgag
aaactacagagagacagaggtttgggcagtgagaaacaccgcaaagaggtttctgatctc
atcaaggagtgcaggcagtctctggctgaaagtctttttgcttgggcttgccagtcaccg
ttagctaaagatgacaccctcctgcttattggacatttagaaagagtgacagtcgaggcc
aacggctccctggatgcagtaaatctggctctcctcatggctcttctgtactgttttgat
accagctttatagaacaaagcacagaggaacgagatgatatgattcaccaccttcccctg
ttgacagagagacagtacattgccacaattcactctcgcctccaggactcccagccttgg
aagctacctgggctgcaggccactgttagacttgcctgggcactggcactgagggggata
tcccagctacctgatgtgacagccctggctgagttcacggaagcagatgaagcgattgca
gaactcgccattgccgataatgtcttcctgttcctcagcgagtctgtcgtgctggctgaa
aacttctatcaggaagagttttatattcgcagaatccataatcttattacagacttcctt
gcatttatgccaatgaaagtgaagcagctgaagaatcgggcagatgaagatgctcgaatg
attcacatgagtatacagatgggtaacgaaccccccatctcacttagaagggacctggaa
cacttgatgctcctgattggtgaactatataaaaaaaacccttttcatttggagcttgct
ctggagtactggtgtccctcagagcctctgcagactcccacggtcatgggctcttacctg
ggagtagctcatcagcgccctcctcagcgccaggttgtcttgtcaaagtttgttagacaa
atgggtgatctgttgccgccaactatttacattccttatttgaagatgctccagggcttg
gccaatgggcctcagtgtgcccactactgttttagcctgctcaaagtcaacggtagtagt
catgttgaaaacattcagggagcaggtggcagtcctgtttcctgggagcatttcttccac
tccttattgctctatcatgagcatctccgaaaggacctgccaagtgcagatagtgtccag
taccggcaccttccttcacgcggcatcacccagaaggagcaagatgggctgatcgctttt
ctccagctgacatctactatcattacttggagtgaaaatgctcgcctggcgctctgtgaa
catccccagtggactcccgttgtggtgattttggggctcctgcagtgcagtattcctcca
gctctcaaagctgagctactgaagacacttgcagcttttgggaagtctcctgaaattgcc
gcttctctctggcagtcattggagtacacgcagatactgcagactgtcagggttccaagc
cagaggcaagctattggtattgaggttgaactcaatgaaatagagtcccggtgtgaagag
tatcccctgactagggccttttgccagttgatcagtaccctggtggagagctcattccct
tctaatctgggtgctggcctgcgcccccctggctttgacccttatttgcagttcctgaga
gattctgtgtttctccgattccgtacaagagcttaccggagagccgctgaaaagtgggaa
gtcgctgaggttgtcctggaagtgttttataagctgttgagagattatgagccccagctt
gaagattttgtagatcagtttgtggagctacaaggagaagagatcatagcctataagcca
cctgggtttagtctgatgtaccatcttctgaacgagtcaccgatgttggaacttgccctc
agcttactggaagaaggagttaagcagcttgatacctatgctcctttccctggaaagaaa
cacctggaaaaagcagttcagcattgcctcgcactcctcaacctcactctgcaaaaggag
aaccttttcatggaccttctgagagagagtcagctggctctcatcgtctcgcctctggaa
cagctcttgcagggaattaaccctaggactaagaaggcagacaatgtggttaacatcgcc
aggtatctgtatcatggaaacagtaatcctgaattggcatttgaaagtgcaaagatcctc
tgctgtatctcttgcaattccaacattcagatcaaaatggttggcgatttcacacatgac
cagaatgtgagccagaagctgatggctggatttgtagagtgcttggatagtgaagacaca
gaagaatttgtacgtgtagaagagggctcagaattagaaaagaaattagctgcaatccgt
cacgaaacgagaatccacatcttgaatcttctcatcacatctctagaacgcagtccaccc
aatctcgccctctacctgttgggctttgaattgaagaaacccatcagtaccacgaatctg
caagacccaggagtactaggctgccctcggacgtgccttcatgccatcctgaacattctg
gagaaaggcaccgacgggaggagcggccctgtggccgtgcaggcgtgtccacagctggcc
gagctgtgctaccaggtgatatatcagttatgtgcatgctcagatacatctggtcctact
atgaggtacttgagaaccagccaggatttcttattttctcagttgcaacatctacctttc
tcgaacaaagagtatgaaatctctatgctgaatcaaatgtcatggcttatgaagactgcc
tcaatagagctaagagtgacgtctctgaatcgccagcgctcacacacacagaggcttctg
catctcttactggatgacctgccggtgaagccgtactctgatggtgaaggaggaatggaa
gatgaaaatagatctgtctctgggttccttcattttgacactgccacaaaagtgcgtcga
aaaattctaagtattcttgattcgattgacttcagtcaggagattcctgagcctttgcag
ctggatttttttgaccgtgcccagattgagcaagtcattgccaattgtgagcacaagaat
ttacaggggcagacggtctgcaatgtcaagcttcttcatagggttctcgtagctgaagtc
aatgctcttcagggtatggcagcaataggccagaggccgctgctgatggaggaaatcagc
actattcttcagtatgtcgtaggaagaaacaagttgctgcagtgtcttcatgcaaagcgg
catgcactggaatcctggaggcagctggtagaaattatcctgacagcttgtcctcaggag
ctcattcaggcagaagatcggcagctgattattcgtgacattttacaagatgtgcatgat
aaggtgctggatgatgaagccgcacaggagctaatgccagtggttgccggtgctgtgttc
accctgactgctcacctaagccaggctgtgcgcacggaacagaagcagccattggtctca
ggacctgcagaggcccattatgctttcatgcttgatagttctttcacctcagctcctgca
gcagagagccagccggtgggctttgcttctattggagattcttcacttcatatcatactg
aagaaactgttggacttcattttgaagacaggtggtggcttccagcgtgtaaggactcac
ctgtatggctcgctgctttattacttacagattgcccagagaccagatgagccggacaca
ttagaagctgctaagaaaactatgtgggaaaggctgactgcccctgaagatgtgtttagt
aaattacagcgagaaaacatggctatcattgagagttacggcgctgcgctcatggaggtg
gtctgtcgagatgcttgcgacggtcatgagattggaaggatgctggccctggctctcctt
gatcggattgtctctgtggacaagcagcagcagtggctcttgtacctttctaacagtggc
tatttgaaggtccttgtagacagcttgctggaagatgatcgcactctacagagcttgctg
actccacagcctcctctcttaaaagccctttatacctatgagtccaagatggcatttctc
acaagagtggctaagctacagcaaggttcattagaactcctaagatcaggggtgattgtg
aggctggcacagtgccaagtctatgatatgcgcccagaagtggactctcatagcatgttt
ggcatgagagacccaccaatattcatcccaacgcctgtggaccgataccggcagattctc
cttccagccctccagctatgccaggtcatcctcacatccagtatgtcccagcacttgcag
gcagcagggcaggtgctgcagtttctcgtttcacattctgataccatccaagcgattctg
cgctgccaggatgttagtgctggctctttgcaggaattagccctgctgacaggaatcata
agtaaagcagcgcttcctggtatgttaaatgaacttgatgtagatgtaaatgaaggatcc
ttaatggagctccagggacacatcgcaaggtttcagcgccagtgcctaggcctactgagt
cgcttcggtggctctgacagactgcggcagtttaaactccaagaagataatgtggaggga
gacaggttgagcaagaaagatgaaattgagctggccatgcagcagatttgtgccaatgta
atggaatattgccattcgttcatgcagcagaactcccctaacctccagaatgctgtgtgt
ctcttcacccctagcctttccgagacggttaacagagatggagcacggcaagatacccag
gttccagtcgttccatactggcgcctgcctggcttgggcattattatctacctgctgaaa
cagagtgccagcgatttctttagctattatgacagtcaccgtcgcagtgtcaacaagctg
cagaatgtagaacaacttcctccagatgagataaaagagttatgccagtctgtgatgcct
gctggcattgataaaatctctacggcgcagaagtgtgtcttagcaagacggcgtctggtg
aagctgatcaacaaccgagccaaactgctgtccctctgctcttatatcatcgagacctgc
ctgtttattctttggcgccatctggagtattacttgttacattgcactccaatggattcc
caagattcactgtttgcctctaggactttacttaaaagcagaagactacaggagcccaat
ctggacttcagcagaagtggactggctcaagtgaaccagcacgatatagaccagctgcag
tctgatgccatcaacgcttttggagaatcactgcaaaagaaactgcttgacatcgaaggg
ttgtattcaaaagttcgatcccgctatagcttcatacaggctcttgtcagacgtatccgt
ggtctgctgaggatatcaaggaactga

DBGET integrated database retrieval system