KEGG   Rattus norvegicus (rat): 362636Help
Entry
362636            CDS       T01003                                 

Gene name
Usp48, Usp31, synUSP
Definition
ubiquitin specific peptidase 48 (EC:3.4.19.12)
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     362636 (Usp48)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   362636 (Usp48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 1036 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGASCYVNTFLQVWFLNLELRQALYLC
PSTCSDYTKGDGIRGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQESSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCSQCGRESKLVSKFYELE
LNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNAYIGFSESLDMEPYVEHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGDWYKFNDEDIEKMEGKKLQLGIEEDLTEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKNHTMVQVPAFLQELVDRDNSKFEEWCVEMAEMRRQSVDKGRAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNNACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKDCVVERCRILRLKNQLNEDYKTVNNLLKATMKGSDGFWVGKSSLR
SWRQLALEQLDEQDGEAEQSNGKINGSPFSKDESKEEKKEEEEELNFNEDILCPHGELSI
SENERRLVSQEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIAKEQKTS
LPNLFQDKNRPCLSNWPEDTDALYIVSHFFLDEWRKFVRKPARSTPVSSVGNAALLCPHG
GLMFTFPSLTKEDSKLIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPN
LCPDCREGLLCQQQKDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKP
DGEKDPDFNQSNGGTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcggctgcagctagagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcatatcgagaccgcctaccgcatctggctggagccctgtatc
cgaggcgtgtgcagaagaaactgcagaggaaatccgaattgcttagttgggattggcgag
cacatttggttaggagaaatagatgagaatagttttcataacattgatgaccccaactgt
gagaggaggaaaaagaattcgtttgtgggcctgactaatctgggagcctcctgttacgtc
aacaccttcctccaggtgtggttcctcaacttggagcttcggcaggcgctatacttatgc
ccaagcacctgtagtgattacacgaagggagatggtatccgtggaggaaaagattatgag
cctcagacaatttgtgagcatcttcagtacttgtttgctttgttgcaaaacagtaacaga
cgatacatcgatccttcaggatttgttaaagccttgggcttggacactggccagcagcag
gatgcacaagagtcttccaagctctttatgtcgctgctggaagacactttgtctaaacag
aagaacccggatgttcggaacgtcgtgcagcagcagttctgtggggagtacgcctatgtg
acagtgtgcagtcagtgtggccgagagtctaagctcgtatcgaagttctatgaactggag
ttaaacatccaaggccacaagcagttaacagactgcatctccgagttcctgaaggaagaa
aggttagaaggagacaatcgatacttctgtgaaaactgtcaaagcaaacagaatgccacg
cggaaaatccgacttctgagcctcccttgcactctgaacttgcagctgatgcgttttgtg
tttgaccggcaaactggacacaagaagaaacttaatgcttatattggcttctcggagagc
ctagatatggagccatatgtggagcacaaaggcgggtcctttgtgtacgagctcagcgcg
gtcctcatccacagaggagtcagtgcctattccggccactacatcgcccacgtgaaagac
ccccagtctggagactggtacaagttcaatgatgaggacatagagaagatggaggggaag
aaactacagctagggattgaggaagatctaacagaaccttctaagtcccagacccgaaaa
cccaagtgtggcaaaggaactcactgctctcgaaatgcatacatgttggtttatagactg
caaacccaggaaaagaaccacacgatggttcaagtcccagcctttctccaagagctggtg
gatcgggataattccaaatttgaagagtggtgtgtagaaatggccgagatgcgcaggcag
agtgtggacaagggcagagcgaagcacgaggaggtgaaggagctgtaccaaaggttgcct
gctggagctgagccctatgagtttgtctctcttgagtggctgcagaagtggctggatgaa
tcaacccctaccaaacctattgataataatgcctgcctgtgttcccatgacaagctccat
ccagacaaaatatcaattatgaagagaatatcggaatacgcagctgacattttctatagt
cgatatggaggaggtcccagactcactgtgaaagccctctgtaaggactgtgttgtggag
cgctgtcgcatactgcgcctgaagaatcaactaaatgaagattacaaaactgtcaacaat
ttgctgaaagcaacaatgaagggcagtgatggattttgggtaggaaagtcttccttgcgc
agctggcgccagctggctcttgagcaactagatgagcaagacggtgaggcggagcaaagc
aatggaaagataaacgggagtcccttcagtaaagatgaatcaaaggaagaaaagaaggaa
gaggaggaggaactaaattttaatgaagacattctgtgtcctcatggagagttaagcata
tctgaaaatgaaagaaggctcgtttctcaggaggcttggagcaaactgcagcagtatttc
ccaaaggctcctgagttcccaagttacaaagagtgctgctcgcaatgcaagatactagaa
cgagaaggtgaagaaaatgaagccttgcataaaatgattgcaaaggagcaaaaaacctca
cttccaaacttgttccaggacaaaaacagaccgtgcctcagtaactggccagaggacacg
gacgctctctatattgtgtcgcacttctttttagatgaatggcggaaattcgttaggaag
cctgcgaggtccactcccgtgtcctcagttgggaacgctgcccttctctgtccacatgga
ggactcatgtttacatttccttccctcaccaaagaagactcgaaacttatagctctcata
tggcccagcgaatggcaaatgattcaaaagctctttgttgtggataaagtaattaaaatc
acaagaattgaagtgggagacgtaaacccttctcaaacacagtatatttctgagcctaat
ctctgtccagattgcagagaaggtctgctgtgccagcagcagaaggaccttcgagagtat
acccaagccaccatctatgtccacaaagttgtggacaacaaaaaggtgatgaaggactca
gctccagagttgaatgtgagtagttctgagacggaggaggacaaggaggaagctaagcca
gacggagagaaagaccctgactttaatcaaagcaatggaggtaccaagcgacagaaaaca
tcccaacagggctatgtggcctaccagaagcaagtcatccggaggagcacgcggcaccgg
aaggttcggggagagaaagcactgctggtgtctgccaaccagacgttaaaagaactgaag
attcagatcatgcatgcattctcagttgctccgtttgaccagaatttgtcaattgatgga
aagattttaaatgatgactgtgctacccttggtaccctcggtgtcattcctgagtctgtc
attttattaaaggcagatgagccaatcgcagactacgctgcaatggatgatgtcatgcaa
gtttgtatgccggaagagggctttaaaggtacaggcctgcttggacattaa

DBGET integrated database retrieval system