KEGG   Rattus norvegicus (rat): 362700Help
Entry
362700            CDS       T01003                                 

Gene name
Spast, Spg4
Definition
(RefSeq) spastin (EC:3.6.4.3)
  KO
K13254  
spastin [EC:3.6.4.3]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.3  microtubule-severing ATPase
     362700 (Spast)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q12
AA seq 581 aa AA seqDB search
MSSPAGRRKKKGSGGASPAPARPPPPAAVPAPAAGPAPAPGSPHKRNLYYFSYPLVVGFA
LLRLLACHLGLLFVWLCQRFSRALMAAKRSSGTAPAPASPSTPAPGPGGEAESVRVFHKQ
AFEYISIALRIDEEEKGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQYERARRLQAKMMT
NLVMAKDRLQLLESGAVPKKKDPLTHASNSLPRSKTVMKSGSTGLSGHHRAPSCSGLSMV
SGARPGSGPAATTHKGTSKPNRTNKPSTPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDN
GTAVKFDDIAGQELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAV
AAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEH
DASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRL
LLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSAS
EMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagttctccggccggacgacggaagaagaaaggctcaggcggcgcgagccccgcgccc
gccaggcctccgccccccgccgcggtccccgcccctgccgccggcccggcccctgcgccc
ggctcgccgcataagcggaacctgtattacttctcgtatccgctggtcgtcggcttcgcc
ctgctgcgcctgctggcctgccacctggggctcctcttcgtgtggctctgccagcgcttc
tcccgcgccctcatggccgccaagaggagctccgggaccgcgccggcgcccgcctcgccc
tcgactccagcccccggaccgggtggcgaggccgagagcgtccgcgtcttccacaagcag
gcctttgagtacatctccattgccctgcgcatcgacgaggaagagaaaggacagaaggaa
caagctgtggaatggtataagaaaggcatcgaagaactagagaaaggaatcgcggttata
gttacgggccaaggtgaacagtacgaaagagctagacgccttcaagccaaaatgatgacg
aatttggttatggctaaggaccgtttacaactcctagaaagtggagcagttccgaagaag
aaagaccccttaacacatgctagtaattcattgcctcgatcaaaaactgtcatgaaaagt
ggatccacagggctctccggtcaccacagggcgcctagttgcagtggtttatccatggtt
tctggagcaagaccgggatctggtcctgcagctaccacacataagggtacttcaaaacca
aatagaaccaacaaaccttctacacccacaactgcagttcggaaaaagaaagacttgaaa
aattttaggaatgtggacagcaatcttgctaaccttataatgaatgaaattgttgacaat
gggacagctgttaaatttgatgatatagctggtcaggaactggcaaaacaagcattgcaa
gagattgtcattctcccttctctgcggcctgagttgttcacagggctcagagctcccgcc
agaggcttgttactcttcggtccaccaggaaacggaaaaaccatgctggctaaagcagta
gctgcagaatctaatgcgacttttttcaatataagtgctgcaagtttaacttcaaaatat
gtaggagagggagagaaattggtgagagctctttttgctgtggctcgagaacttcaaccc
tctataatttttatagatgaagttgatagtcttttgtgtgagagaagagaaggggagcac
gatgctagtagacgactaaaaactgaatttttaatagaatttgatggtgtgcagtctgct
ggagatgacagagtcctcgtaatgggtgcaaccaacaggccccaagagctggatgaagct
gttctcaggcgtttcattaaacgggtgtatgtgtcattacccaatgaggagacacgacta
cttctacttaaaaacctgttatgtaaacaaggaagtccactgacccaaaaagaacttgct
caactggcgagaatgactgatggatactctggaagtgatctgactgctttggcaaaggat
gcagcactgggtcctatccgagaactgaaaccagagcaggtgaagaacatgtctgccagt
gagatgagaaatattcgattatctgacttcacagaatccttaaaaaagatcaaacgcagt
gtgagtcctcagactttagaagcatacatacgctggaacaaggactttggagacaccact
gtttaa

DBGET integrated database retrieval system