KEGG   Rattus norvegicus (rat): 362706Help
Entry
362706            CDS       T01003                                 

Gene name
Rbks
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    362706 (Rbks)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     362706 (Rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q13
AA seq 323 aa AA seqDB search
MAASGEPGRLWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQC
VQAARLGAKAAMVCKVGNDSFGNNYIENLKQNHISTEFTYQTRDAATGTASIIVNNEGQN
IIVIVAGANLLLNTEDLKKAAHVISRAKVMICQLEISPAASLEALTMARSSGVKTLFNPA
PAIADLDPRFYTLSTVFCCNESEAEILTGHAVNDPTTAGTAALVLLERGCQVVVITLGAS
GCVTLSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYLAYYPSLSLEEMLKRSNSIAA
VSVQATGTQSSYPYKKDLPLALF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcaggggagcccgggaggctctggcaggaggaagaggcggcagcagtggtg
gtggtgggttcctgcatgaccgacctggtcagtcttacttctcgcttgccaaaaactgga
gaaactatccatggacacaagttttttattggctttggaggaaaaggtgccaaccagtgt
gtccaagctgcccgactgggagcaaaggcagccatggtctgcaaggttggcaatgattct
tttggcaataattacatagaaaacttaaaacaaaatcatatttctacagagtttacatac
cagaccagagatgcagctacaggaacagcctccataattgtcaataatgaaggccagaac
atcatcgtcatagtggctggagcaaatctgctcttgaatactgaagacttgaagaaggca
gcccatgtcattagccgagccaaagtgatgatctgccagctagaaataagcccggcagct
tctctggaagccctgacaatggcccgcagcagtggagtgaaaacattgttcaacccagct
ccggccattgctgacctggacccccggttctacaccctctccactgtgttctgctgcaac
gagagtgaggctgagatcctaacaggccacgcagtgaatgacccaaccacggctggaacg
gctgcgctggttctcctagaacggggctgccaggttgtggtcatcaccctaggggcttca
ggatgtgtgacactgtcacaggcagaacctgttccaaagcacattcccacagaagcagtc
aaggctgtggacaccacgggtgctggtgacagttttgtgggagcgcttgccttctacctg
gcttactacccaagtctgtccttggaagaaatgctcaagagatctaattccatcgctgcg
gtcagcgtccaggccacaggaacacagtcctcttatccatacaaaaaagacctccctctt
gctctattttaa

DBGET integrated database retrieval system